CD40L/CD154/TRAP Trimer Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
CD40L (CD154; TRAP) is a ligand to CD40/TNFRSF5, acts function by generating a costimulatory signal that up-regulates IL-4 synthesis. CD40L is specifically expressed on activated CD4+ T-lymphocytes and involves in activation of NF-κB/MAPK pathway. CD40L also involves in B cell differentiation, maturation, and apoptosis. CD40L in mouse, cleaved into 2 chains of membrane form (1-260 a.a.) and soluble form (112-260 a.a.) which serves as a ligand for integrins (ITGA5:ITGB1 and ITGAV:ITGB3). CD40L/CD154/TRAP Trimer Protein, Mouse (HEK293, Fc) has a total length of 149 amino acids (M112-L260), is expressed in HEK392 cells with N-terminal hFc-tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD40L (CD154; TRAP) is a ligand to CD40/TNFRSF5, acts function by generating a costimulatory signal that up-regulates IL-4 synthesis[1]. CD40L is specifically expressed on activated CD4+ T-lymphocytes and involves in activation of NF-κB/MAPK pathway[2][3]. CD40L also involves in B cell differentiation, maturation, and apoptosis[4]. CD40L in mouse, cleaved into 2 chains of membrane form (1-260 a.a.) and soluble form (112-260 a.a.) which serves as a ligand for integrins (ITGA5:ITGB1 and ITGAV:ITGB3). CD40L/CD154/TRAP Trimer Protein, Mouse (HEK293, Fc) has a total length of 149 amino acids (M112-L260), is expressed in HEK392 cells with N-terminal hFc-tag.
Background
CD40 Ligand (CD40L; CD154; TRAP) belongs to the tumor necrosis factor (TNF) family, is the ligand for CD40/TNFRSF5, specifically expressed on activated CD4+ T-lymphocytes[1].
CD40L is a type II transmembrane protein on B cells triggers important signals for B cell differentiation, maturation, and apoptosis[4].
CD40L acts function by cross-linking on T-cells to generate a costimulatory signal and thus enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation, as well as promoting the production of interferon-γ, and TNF-α[1][4].
CD40L, binding with CD40 on antigen-presenting cells (APC), activates TNFR-associated factor 2- and IKK2-dependent pathways with stimulating I-κB kinase (IKK), increasing NF-κB DNA binding, and p65 nuclear translocation. The activation of I-κB kinase leads to strongly c-Jun N-terminal kinase activation as well as GST-I-κB and GST-p65 phosphorylation[2].
CD40L involves in MAPK pathways that strongly repress Bcl-6 with inducing the phosphorylation of Erk1/2, p38 and Jnk1/2 and activating IRF4 mediated by NF-κB[3].
CD40L also binds to and signals through several integrins, including αvβ3 and α5β1, which bind to the trimeric interface of CD40L. CD40L plays a major role in immune response and is a major target for inflammation[5].
CD40L is widely found in different animals, while the sequence in Mouse is highly similar to Rat (93.85%), but very different from Human and Rhesus macaque with similarities of 77.69% and 77.31%, respectively. CD40L in Mouse is cleaved into 2 chains of membrane form (1-260 a.a.) and soluble form (112-260 a.a.), while the soluble form in human derives from the membrane form by proteolytic processing. Release of soluble CD40L from platelets is partially regulated by GP IIb/IIIa, actin polymerization, and a matrix metalloproteinases (MMP) inhibitor-sensitive pathway[6].
In Vitro
CD40 Ligand lacking in mice (CD40L-deficient) results CLP-induced edema and myeloperoxidase activity in the lung as well as neutrophil infiltration in the broncoalveolar space markedly reduced[7].
In Vivo
CD40 Ligand (100 ng/mL; 10 min) doesn’t stimulate Mac-1 expression in murine blood neutrophils indicating a MIP-2-dependent manner[7].
CD40 Ligand (100 ng/mL; 10 min) regulates plasma levels of MIP-2 in plasma of cecal ligation and puncture (CLP) mice[7].
Verified Bioactivity
1. Immobilized Mouse CD40, His Tag at 1 μg/ml (100 μL/Well) on the plate. Dose response curve for Mouse CD40 Ligand (Trimer), hFc Tag with the EC50 of 0.10 μg/ml determined by ELISA.
2. Immobilized Mouse CD40, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Mouse CD40 Ligand Trimer, hFc Tag with the EC50 of 3.2 ng/mL determined by ELISA.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
P27548 (M112-L260)
-
Molecular Construction
-
N-term
-
hFc
-
CD40L (M112-L260)
Accession # P27548 -
C-term
-
-
Protein Length
Full Length of CD40 ligand, soluble form
-
Synonyms
CD40LG; T-BAM; Prev. TNFSF5; Tumor Necrosis Factor (Ligand) Superfamily Member 5; Prev. HIGM1; Tumor Necrosis Factor Ligand Superfamily Member 5; Prev. IMD3; T-B Cell-Activating Molecule; CD40-L; CD40 Antigen Ligand; CD40L; T-Cell Antigen Gp39; TRAP; Tumo
-
AA Sequence
MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
-
Predicted Molecular Mass
75.6 kDa
-
Molecular Weight
Approximately 76-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose or PBS, 200 mM L-arginine (pH 7.4), 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (266 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Blotta MH, et al. Cross-linking of the CD40 ligand on human CD4+ T lymphocytes generates a costimulatory signal that up-regulates IL-4 synthesis. J Immunol. 1996 May 1;156(9):3133-40. [Content Brief]
[2]. Schwabe RF, et al. CD40 activates NF-kappa B and c-Jun N-terminal kinase and enhances chemokine secretion on activated human hepatic stellate cells. J Immunol. 2001 Jun 1;166(11):6812-9. [Content Brief]
[3]. Batlle A, et al. CD40 and B-cell receptor signalling induce MAPK family members that can either induce or repress Bcl-6 expression. Mol Immunol. 2009 May;46(8-9):1727-35. [Content Brief]
[4]. Mikolajczak SA, et al. The modulation of CD40 ligand signaling by transmembrane CD28 splice variant in human T cells. J Exp Med. 2004 Apr 5;199(7):1025-31. [Content Brief]
[5]. Takada YK, et al. Soluble CD40L activates soluble and cell-surface integrin αvβ3, α5β1, and α4β1 by binding to the allosteric ligand-binding site (site 2). J Biol Chem. 2021 Jan-Jun;296:100399. [Content Brief]
[6]. Pietravalle F, et al. Human native soluble CD40L is a biologically active trimer, processed inside microsomes. J Biol Chem. 1996 Mar 15;271(11):5965-7. [Content Brief]
[7]. Rahman M, et al. Platelet-derived CD40L (CD154) mediates neutrophil upregulation of Mac-1 and recruitment in septic lung injury. Ann Surg. 2009 Nov;250(5):783-90. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
