CORS26 Protein, Mouse (Myc, His)

CORS26 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. CORS26 Protein involved in the LAMP1-STAT3, SIRT1/NF-魏B/p53, NF-魏B and TGF-尾1/Smad3 pathways play anti-inflammatory effects. CORS26 Protein also inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by toll-like receptors (TLR). CORS26 Protein, Mouse (Myc, His) is the recombinant mouse-derived CORS26 protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of CORS26 Protein, Mouse (Myc, His) is 224 a.a., with molecular weight of ~31.1 kDa.

C1q/ TNF-associated proteins (CTRPs) are a family of secreted proteins with a specific structure. Complement C1q tumor necrosis factor-related protein 3 shows anti-inflammatory action in psoriasis via the LAMP1-STAT3 axis. C1qtnf3 improves protein-induced severe acute pancreatitis in mice via the SIRT1/NF-κB/p53 axis. C1qtnf3 regulates NF-κB and TGF-β1/Smad3 pathways to reduce airway inflammation and remodeling in ovalbumin (OVA) -induced asthmatic mice. C1qtnf3 inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by Toll-like receptors (TLR)^[1][2][3][4].

Mouse

E. coli

N-His;C-Myc

Q9ES30 (23Q-246K)

81799  [NCBI]

QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Approximately 31.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.