Cry2 Protein, Mouse (His, Myc)

Cry2 Protein, Mouse (His, Myc) is the recombinant mouse-derived Cry2 protein, expressed by E. coli, with N-10*His & C-Myc tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cry2 Protein, Mouse (His, Myc) is the recombinant mouse-derived Cry2 protein, expressed by E. coli, with N-10*His & C-Myc tag.

Background

Cry2 is a transcriptional repressor that forms a core component of the circadian clock, an internal time-keeping system regulating physiological processes through ~24-hour rhythms in gene expression, metabolism, and behavior. Derived from Latin 'circa' (about) and 'diem' (day), it governs functions like metabolism, sleep, and cardiovascular activity. The clock comprises the central clock in the brain's suprachiasmatic nucleus (SCN) and peripheral clocks in tissues, synchronized by Zeitgebers ('timegivers'), primarily light for the SCN. Cry2, alongside Cry1, participates in the transcription-translation feedback loop (TTFL): CLOCK/NPAS2-BMAL1/2 heterodimers activate E-box-containing clock genes, while PER/CRY proteins inhibit them to generate rhythms. Though functionally redundant with Cry1, Cry2 differentially tunes SCN pace by opposing Cry1's effects and is vital for intercellular rhythm synchrony. It mediates circadian cAMP/gluconeogenesis regulation by blocking glucagon-induced cAMP/CREB1 activation. Beyond clock maintenance, Cry2 modulates glucose/lipid metabolism (e.g., via LEP, ACSL4), represses glucocorticoid receptor NR3C1/GR, and limits skeletal muscle PPARD signaling to restrict exercise capacity (by similar: PubMed:28683290). It also inhibits NR1I2 transcriptional activity (by similar: PubMed:28751364).

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-10*His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • Cry2(M1-S529)
      Accession # Q9R194
    • Myc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    UST; Uronyl 2-Sulfotransferase; 2OST; Chondroitin Sulfate 2-O-Sulfotransferase; CS-2OST; Dermatan/Chondroitin Sulfate 2-Sulfotransferase; DS2ST

  • AA Sequence

    MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLS

  • Predicted Molecular Mass

    74.3 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00