Cry2 Protein, Mouse (His, Myc)
Cry2 Protein, Mouse (His, Myc) is the recombinant mouse-derived Cry2 protein, expressed by E. coli, with N-10*His & C-Myc tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Cry2 Protein, Mouse (His, Myc) is the recombinant mouse-derived Cry2 protein, expressed by E. coli, with N-10*His & C-Myc tag.
Background
Cry2 is a transcriptional repressor that forms a core component of the circadian clock, an internal time-keeping system regulating physiological processes through ~24-hour rhythms in gene expression, metabolism, and behavior. Derived from Latin 'circa' (about) and 'diem' (day), it governs functions like metabolism, sleep, and cardiovascular activity. The clock comprises the central clock in the brain's suprachiasmatic nucleus (SCN) and peripheral clocks in tissues, synchronized by Zeitgebers ('timegivers'), primarily light for the SCN. Cry2, alongside Cry1, participates in the transcription-translation feedback loop (TTFL): CLOCK/NPAS2-BMAL1/2 heterodimers activate E-box-containing clock genes, while PER/CRY proteins inhibit them to generate rhythms. Though functionally redundant with Cry1, Cry2 differentially tunes SCN pace by opposing Cry1's effects and is vital for intercellular rhythm synchrony. It mediates circadian cAMP/gluconeogenesis regulation by blocking glucagon-induced cAMP/CREB1 activation. Beyond clock maintenance, Cry2 modulates glucose/lipid metabolism (e.g., via LEP, ACSL4), represses glucocorticoid receptor NR3C1/GR, and limits skeletal muscle PPARD signaling to restrict exercise capacity (by similar: PubMed:28683290). It also inhibits NR1I2 transcriptional activity (by similar: PubMed:28751364).
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q9R194 (M1-S529)
-
Gene ID10090
-
Molecular Construction
-
N-term
-
10*His
-
Cry2(M1-S529)
Accession # Q9R194 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
UST; Uronyl 2-Sulfotransferase; 2OST; Chondroitin Sulfate 2-O-Sulfotransferase; CS-2OST; Dermatan/Chondroitin Sulfate 2-Sulfotransferase; DS2ST
-
AA Sequence
MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLS
-
Predicted Molecular Mass
74.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)