DYRK3 Protein, Human (Active, sf9, His-GST)
DYRK3 is a dual-specificity protein kinase that dissociates membraneless organelles such as stress granules and nuclear speckles in mitosis. DYRK3 Protein, Human (sf9, His-GST) is the recombinant human-derived DYRK3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
DYRK3 is a dual-specificity protein kinase that dissociates membraneless organelles such as stress granules and nuclear speckles in mitosis. DYRK3 Protein, Human (sf9, His-GST) is the recombinant human-derived DYRK3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
DYRK3, a dual-specificity protein kinase, plays a pivotal role in orchestrating the disassembly of various membraneless organelles, including stress granules, nuclear speckles, and pericentriolar material, during mitosis. Operating as a central dissolvase during the G2-to-M transition, DYRK3 achieves this by phosphorylating multiple serine and threonine residues in unstructured domains of target proteins, such as SRRM1 and PCM1. Notably, DYRK3's dissolving activity is selective, sparing membraneless organelles like P-bodies and the nucleolus. This orchestrated disassembly is crucial for releasing mitotic regulators, including ZNF207, from liquid-unmixed organelles, preventing their sequestration and maintaining dissolution during mitosis. Additionally, DYRK3 regulates mTORC1 by mediating stress granule dissolution and facilitating mTORC1 relocation to the cytosol, a process essential for full reactivation of mTORC1 signaling. Beyond its role in organelle dynamics, DYRK3 emerges as a negative regulator of EPO-dependent erythropoiesis, potentially imposing an upper limit on red cell production during stress erythropoiesis. Furthermore, DYRK3 exhibits a pro-survival function, inhibiting cell death induced by cytokine withdrawal in hematopoietic progenitor cells and promoting cell survival under genotoxic stress through the phosphorylation of SIRT1, consequently inhibiting p53/TP53 activity and apoptosis.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
O43781 (M1-S588)
-
Molecular Construction
-
N-term
-
His-GST
-
DYRK3 (M1-S588)
Accession # O43781 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
DYRK3; Dual Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 3; Dual Specificity Tyrosine Phosphorylation Regulated Kinase 3; Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 3; REDK; Protein Kinase Dyrk3; Regulatory Erythroid Kinase; D
-
AA Sequence
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
-
Predicted Molecular Mass
93.5 kDa
-
Molecular Weight
Approximately 80 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)