1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. DYRK
  5. DYRK3
  6. DYRK3 Protein, Human (Active, sf9, His-GST)

DYRK3 is a dual-specificity protein kinase that dissociates membraneless organelles such as stress granules and nuclear speckles in mitosis. DYRK3 Protein, Human (sf9, His-GST) is the recombinant human-derived DYRK3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 weeks 1 - 2 Weeks 3 - 4 weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DYRK3 is a dual-specificity protein kinase that dissociates membraneless organelles such as stress granules and nuclear speckles in mitosis. DYRK3 Protein, Human (sf9, His-GST) is the recombinant human-derived DYRK3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

DYRK3, a dual-specificity protein kinase, plays a pivotal role in orchestrating the disassembly of various membraneless organelles, including stress granules, nuclear speckles, and pericentriolar material, during mitosis. Operating as a central dissolvase during the G2-to-M transition, DYRK3 achieves this by phosphorylating multiple serine and threonine residues in unstructured domains of target proteins, such as SRRM1 and PCM1. Notably, DYRK3's dissolving activity is selective, sparing membraneless organelles like P-bodies and the nucleolus. This orchestrated disassembly is crucial for releasing mitotic regulators, including ZNF207, from liquid-unmixed organelles, preventing their sequestration and maintaining dissolution during mitosis. Additionally, DYRK3 regulates mTORC1 by mediating stress granule dissolution and facilitating mTORC1 relocation to the cytosol, a process essential for full reactivation of mTORC1 signaling. Beyond its role in organelle dynamics, DYRK3 emerges as a negative regulator of EPO-dependent erythropoiesis, potentially imposing an upper limit on red cell production during stress erythropoiesis. Furthermore, DYRK3 exhibits a pro-survival function, inhibiting cell death induced by cytokine withdrawal in hematopoietic progenitor cells and promoting cell survival under genotoxic stress through the phosphorylation of SIRT1, consequently inhibiting p53/TP53 activity and apoptosis.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

O43781 (M1-S588)

Gene ID
Molecular Construction
N-term
His-GST
DYRK3 (M1-S588)
Accession # O43781
C-term
Protein Length

Full Length

Synonyms
Dual specificity tyrosine-phosphorylation-regulated kinase 3; REDK; DYRK3
AA Sequence

MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS

Predicted Molecular Mass
93.5 kDa
Molecular Weight

Approximately 80 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 0.5 mM PMSF, 10% gly, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

DYRK3 Protein, Human (Active, sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DYRK3 Protein, Human (Active, sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DYRK3 Protein, Human (Active, sf9, His-GST)
Cat. No.:
HY-P76308
Quantity:
MCE Japan Authorized Agent: