DYRK3 Protein, Human (Active, sf9, His-GST)

DYRK3 is a dual-specificity protein kinase that dissociates membraneless organelles such as stress granules and nuclear speckles in mitosis. DYRK3 Protein, Human (sf9, His-GST) is the recombinant human-derived DYRK3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

DYRK3 is a dual-specificity protein kinase that dissociates membraneless organelles such as stress granules and nuclear speckles in mitosis. DYRK3 Protein, Human (sf9, His-GST) is the recombinant human-derived DYRK3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

DYRK3, a dual-specificity protein kinase, plays a pivotal role in orchestrating the disassembly of various membraneless organelles, including stress granules, nuclear speckles, and pericentriolar material, during mitosis. Operating as a central dissolvase during the G2-to-M transition, DYRK3 achieves this by phosphorylating multiple serine and threonine residues in unstructured domains of target proteins, such as SRRM1 and PCM1. Notably, DYRK3's dissolving activity is selective, sparing membraneless organelles like P-bodies and the nucleolus. This orchestrated disassembly is crucial for releasing mitotic regulators, including ZNF207, from liquid-unmixed organelles, preventing their sequestration and maintaining dissolution during mitosis. Additionally, DYRK3 regulates mTORC1 by mediating stress granule dissolution and facilitating mTORC1 relocation to the cytosol, a process essential for full reactivation of mTORC1 signaling. Beyond its role in organelle dynamics, DYRK3 emerges as a negative regulator of EPO-dependent erythropoiesis, potentially imposing an upper limit on red cell production during stress erythropoiesis. Furthermore, DYRK3 exhibits a pro-survival function, inhibiting cell death induced by cytokine withdrawal in hematopoietic progenitor cells and promoting cell survival under genotoxic stress through the phosphorylation of SIRT1, consequently inhibiting p53/TP53 activity and apoptosis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • DYRK3 (M1-S588)
      Accession # O43781
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    DYRK3; Dual Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 3; Dual Specificity Tyrosine Phosphorylation Regulated Kinase 3; Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 3; REDK; Protein Kinase Dyrk3; Regulatory Erythroid Kinase; D

  • AA Sequence

    MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS

  • Predicted Molecular Mass

    93.5 kDa

  • Molecular Weight

    Approximately 80 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00