Epigen Protein, Human (E. coli)
Based on 1 Customer Validation
Epigen Protein, Human (E. coli) is the recombinant human-derived Epigen, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Epigen Protein, Human (E. coli) is the recombinant human-derived Epigen, expressed by E. coli , with tag Free labeled tag.
Background
Epigen is a product that promotes the growth of epithelial cells, potentially by stimulating the phosphorylation of EGFR and mitogen-activated protein kinases.
Verified Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 116.1 ng/mL, corresponding to a specific activity is 8.61×103 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q6UW88-1 (A24-A104)
-
Gene ID255324
-
Molecular Construction
-
N-term
-
Epigen (A24-A104)
Accession # Q6UW88-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
EPGN; ALGV3072; Epithelial Mitogen; PRO9904; Epigen; Epithelial Mitogen Homolog (Mouse); EPG; Epithelial Mitogen Homolog
-
AA Sequence
AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
-
Predicted Molecular Mass
9 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)