1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. TGF-alpha
  5. TGF alpha/TGFA Protein, Mouse (HEK293, Fc)

TGF α/TGFA is a mitogenic peptide that binds to the EGF receptor (EGFR) and acts synergistically with TGF β to achieve anchorage-independent cell proliferation in soft agar.It interacts with SDCBP and the SNTA1 PDZ domain, which is critical for cell surface localization.TGF alpha/TGFA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGF alpha/TGFA protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE TGF alpha/TGFA Protein, Mouse (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGF α/TGFA is a mitogenic peptide that binds to the EGF receptor (EGFR) and acts synergistically with TGF β to achieve anchorage-independent cell proliferation in soft agar.It interacts with SDCBP and the SNTA1 PDZ domain, which is critical for cell surface localization.TGF alpha/TGFA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGF alpha/TGFA protein, expressed by HEK293 , with N-hFc labeled tag.

Background

TGF alpha, a mitogenic polypeptide, exhibits the ability to bind to the EGF receptor (EGFR) and synergistically collaborate with TGF beta to facilitate anchorage-independent cell proliferation in soft agar. It interacts with the PDZ domains of SDCBP and SNTA1, with the former being crucial for its localization to the cell surface. In its immature form, present in the endoplasmic reticulum and characterized by a prosegment and partial N-glycosylation, TGF alpha interacts with CNIH. Within the Golgi apparatus, it may form a complex with CNIH and GORASP2. Additionally, TGF alpha interacts with NKD2 through its cytoplasmic C-terminal domain and with MAGI3.

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <0.4 ng/mL.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.2054 ng/mL, corresponding to a specific activity is 4.869×106 units/mg.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P48030 (V39-A88)

Gene ID
Molecular Construction
N-term
hFc
TGF-α (V39-A88)
Accession # P48030
C-term
Protein Length

Full Length of TGFA

Synonyms
ETGF; TGF-alpha; TGF type 1; TGFA
AA Sequence

VVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA

Predicted Molecular Mass
32.9 kDa
Molecular Weight

Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TGF alpha/TGFA Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TGF alpha/TGFA Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF alpha/TGFA Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77857
Quantity:
MCE Japan Authorized Agent: