Copy Link Print Information

TGF alpha/TGFA Protein, Mouse (HEK293, Fc)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

TGF α/TGFA is a mitogenic peptide that binds to the EGF receptor (EGFR) and acts synergistically with TGF β to achieve anchorage-independent cell proliferation in soft agar.It interacts with SDCBP and the SNTA1 PDZ domain, which is critical for cell surface localization.TGF alpha/TGFA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGF alpha/TGFA protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TGF alpha/TGFA Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for TGF alpha/TGFA Protein, Mouse (HEK293, Fc)
  • TGF alpha/TGFA Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TGF α/TGFA is a mitogenic peptide that binds to the EGF receptor (EGFR) and acts synergistically with TGF β to achieve anchorage-independent cell proliferation in soft agar.It interacts with SDCBP and the SNTA1 PDZ domain, which is critical for cell surface localization.TGF alpha/TGFA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGF alpha/TGFA protein, expressed by HEK293 , with N-hFc labeled tag.

Background

TGF alpha, a mitogenic polypeptide, exhibits the ability to bind to the EGF receptor (EGFR) and synergistically collaborate with TGF beta to facilitate anchorage-independent cell proliferation in soft agar. It interacts with the PDZ domains of SDCBP and SNTA1, with the former being crucial for its localization to the cell surface. In its immature form, present in the endoplasmic reticulum and characterized by a prosegment and partial N-glycosylation, TGF alpha interacts with CNIH. Within the Golgi apparatus, it may form a complex with CNIH and GORASP2. Additionally, TGF alpha interacts with NKD2 through its cytoplasmic C-terminal domain and with MAGI3.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <0.4 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.2054 ng/mL, corresponding to a specific activity is 4.869×106 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession

    P48030 (V39-A88)

  • Gene ID
    21802  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • TGF-α (V39-A88)
      Accession # P48030
    • C-term
  • Protein Length

    Full Length of TGFA Chain

  • Synonyms

    TGFA; Transforming Growth Factor, Alpha; Transforming Growth Factor Alpha; TGF-Alpha; Protransforming Growth Factor Alpha; TFGA; Transforming Growth Factor, Alpha, Isoform CRA_d

  • AA Sequence

    VVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA

  • Predicted Molecular Mass

    32.9 kDa

  • Molecular Weight

    Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.2054 ng/mL, corresponding to a specific activity is 4.869×106 units/mg.

  • TGF alpha/TGFA Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for TGF alpha/TGFA Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for TGF alpha/TGFA Protein, Mouse (HEK293, Fc)
  • TGF alpha/TGFA Protein, Mouse (HEK293, Fc) Product Image