TGF alpha/TGFA Protein, Mouse (HEK293, Fc)

TGF α/TGFA is a mitogenic peptide that binds to the EGF receptor (EGFR) and acts synergistically with TGF β to achieve anchorage-independent cell proliferation in soft agar.It interacts with SDCBP and the SNTA1 PDZ domain, which is critical for cell surface localization.TGF alpha/TGFA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TGF alpha/TGFA protein, expressed by HEK293 , with N-hFc labeled tag.

TGF alpha, a mitogenic polypeptide, exhibits the ability to bind to the EGF receptor (EGFR) and synergistically collaborate with TGF beta to facilitate anchorage-independent cell proliferation in soft agar. It interacts with the PDZ domains of SDCBP and SNTA1, with the former being crucial for its localization to the cell surface. In its immature form, present in the endoplasmic reticulum and characterized by a prosegment and partial N-glycosylation, TGF alpha interacts with CNIH. Within the Golgi apparatus, it may form a complex with CNIH and GORASP2. Additionally, TGF alpha interacts with NKD2 through its cytoplasmic C-terminal domain and with MAGI3.

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is <0.4 ng/mL.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.2054 ng/mL, corresponding to a specific activity is 4.869×10⁶ units/mg.

Mouse

HEK293

N-hFc

P48030 (V39-A88)

21802  [NCBI]

Full Length of TGFA

VVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA

Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.