ESM-1 Protein, Human (HEK293, His)
Based on 1 publication(s) in Google Scholar
ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Human (HEK293, His) is the recombinant human-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Human (HEK293, His) is the recombinant human-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
ESM-1 (Endocan) plays a crucial role in angiogenesis, promoting the sprouting of new blood vessels. It is implicated in lung endothelial cell-leukocyte interactions, suggesting its potential significance in regulating immune responses within the pulmonary vasculature.
Verified Bioactivity
Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.5-2.5 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9NQ30-1/AAH11989.1 (W20-R184)
-
Molecular Construction
-
N-term
-
ESM-1 (W20-R184)
Accession # AAH11989.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ESM1; ESM-1; Endothelial Cell Specific Molecule 1; Endocan; Endothelial Cell-Specific Molecule 1
-
AA Sequence
WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
-
Molecular Weight
Approximately 20-27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
