FGF-18 Protein, Mouse
Based on 1 Customer Validation
FGF-18 Protein, Mouse is a trophic factor for mature chondrocytes and their progenitors.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
FGF-18 Protein, Mouse is a trophic factor for mature chondrocytes and their progenitors.
Mouse Fibroblast Growth Factor-18 (FGF18) is a trophic factor for mature chondrocytes and their progenitors[1]. FGF18 has been reported to have significant anabolic effects on cartilage. FGF18 plays a central role in skeletal growth and development. Mice lacking Fgf18 exhibit malformations in cartilage and bone, including delayed closure of the calvarial sutures, enlargement of the proliferating and hypertrophic zones in the growth plate of long bones, defects in joint development, and delays in osteogenic differentiation[2].
1. The ED50 is <0.5 μg/mL as measured by 3T3 cells, corresponding to a specific activity of >2.0 × 103 units/mg.
2. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of 2.0 × 106 IU/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
O89101 (E28-G207)
-
Molecular Construction
-
N-term
-
FGF-18 (E28-G207)
Accession # O89101 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF18; ZFGF5; Fibroblast Growth Factor 18; Fibroblast Growth Factor; FGF-18; FGF
-
AA Sequence
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG
-
Predicted Molecular Mass
20.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 500 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 500 mM NaCl.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Ellsworth JL, et al. Fibroblast growth factor-18 is a trophic factor for mature chondrocytes and their progenitors. Osteoarthritis Cartilage. 2002 Apr;10(4):308-20. [Content Brief]
[2]. Moore EE, et al. Fibroblast growth factor-18 stimulates chondrogenesis and cartilage repair in a rat model of injury-induced osteoarthritis. Osteoarthritis Cartilage. 2005 Jul;13(7):623-31. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
