Copy Link Print Information

FGF-4 Protein, Human

12 Cited Publications
Customer Review

Based on 12 publication(s) in Google Scholar

FGF-4 Protein is an important member of the fibroblast growth factor (FGF) family. By binding to FGFRs (especially FGFR1 and FGFR2), FGF-4 Protein can activate downstream signaling pathways such as RAS-MAPK and PI3K-AKT. FGF-4 Protein plays a key role in physiological processes such as cell growth, differentiation, migration, and angiogenesis. FGF-4 Protein, Human is a recombinant FGF-4 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-4 Protein, Human
  • Experimental Validation Results for FGF-4 Protein, Human
  • FGF-4 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-4 Protein is an important member of the fibroblast growth factor (FGF) family. By binding to FGFRs (especially FGFR1 and FGFR2), FGF-4 Protein can activate downstream signaling pathways such as RAS-MAPK and PI3K-AKT. FGF-4 Protein plays a key role in physiological processes such as cell growth, differentiation, migration, and angiogenesis. FGF-4 Protein, Human is a recombinant FGF-4 protein expressed by E. coli without a tag[1][2][3].

Background

FGF-4 Protein is encoded by the hst oncogene. FGF-4 Protein can bind to the FGFR2 receptor through autocrine/paracrine actions to stimulate endothelial cell proliferation and angiogenesis. However, when overexpressed, its ability to induce cell transformation and invasion is weaker than that of FGF-2, and it cannot trigger hemangiomas[1].

In Vitro

FGF-4 Protein (1.0-10 ng/mL; 20 min-22 h) can stimulate DNA synthesis and ERK1/2 phosphorylation in mouse aortic endothelial cells[1].
FGF-4 Protein (Human; 25 ng/mL) can be used for the preparation of trophoblast stem cell (TSCs) culture medium to maintain the proliferation and stemness of TSCs[2].
FGF-4 Protein (Human; 5-25 ng/mL; 12-24 days) can promote the proliferation of human bone marrow-derived mesenchymal stem cells without affecting cell phenotype and pluripotency[3].

Verified Bioactivity

The ED50 is ≤1.5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of ≥6.67 × 105 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P08620-1 (A31-L206)

  • Gene ID
    2249  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-4 (A31-L206)
      Accession # P08620
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    FGF4; Heparin-Binding Growth Factor 4; Prev. HSTF1; HSTF-1; HBGF-4; FGF-4; HST-1; Heparin Secretory-Transforming Protein 1; HST; Fibroblast Growth Factor; Transforming Protein KS3; Oncogene HST; K-FGF; SRTD22; KFGF; KS3; Human Stomach Cancer, Transforming

  • AA Sequence

    APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

  • Predicted Molecular Mass

    19.8 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 750 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 750 mM NaCl, pH 7.5, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Dell'Era P, et al. Paracrine and autocrine effects of fibroblast growth factor-4 in endothelial cells. Oncogene. 2001 May 10;20(21):2655-63. [Content Brief]

[2]. Zhang W, et al. Capture of Totipotency in Mouse Embryonic Stem Cells in the Absence of Pdzk1. Adv Sci (Weinh). 2025 Feb;12(6):e2408852. [Content Brief]

[3]. Farré J, et al. FGF-4 increases in vitro expansion rate of human adult bone marrow-derived mesenchymal stem cells. Growth Factors. 2007 Apr;25(2):71-6. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH/3T3 cells. The ED50for this effect is 1.38 ng/mL, corresponding to a specific activity is 7.246×105 units/mg.

  • FGF-4 Protein, Human Product Image
    1/16
  • Experimental Validation Results for FGF-4 Protein, Human
  • Experimental Validation Results for FGF-4 Protein, Human
  • FGF-4 Protein, Human Product Image