1. Recombinant Proteins
  2. FGF-4 Protein, Human (166a.a)

FGF-4 Protein, Human (166a.a)

Cat. No.: HY-P7014
Handling Instructions

FGF-4 Protein, Human (166a.a) is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg $600 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE FGF-4 Protein, Human (166a.a)

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuFGF-4; HBGF-4; HST; HST-1; HSTF1
Species

Human

Source

E. coli

Accession

P08620 (A41-L206)

Gene ID

2249

Molecular Weight

Approximately 19.4 kDa

AA Sequence

MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Biological Activity
The ED50 is <0.5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >2.0 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM HEPES, 750 mM NaCl, pH 7.5.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Fibroblast Growth Factor 4 (EGF 4) is a member of the FGF family that transforms 3T3 cells with high efficiency, stimulates endothelial cell proliferation, migration, and protease production, and shows angiogenic activity[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-4 Protein, Human (166a.a)
Cat. No.:
HY-P7014
Quantity:
MCE Japan Authorized Agent: