FGF-8a Protein, Human
Based on 1 Customer Validation
GF-8a Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
GF-8a Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.
Fibroblast Growth Factor 8 is an essential factor during embryonic development, overexpressed in several tumor types. Fibroblast Growth Factor 8 stimulates anti-apoptotic pathways and prevents tumor cell death[1].
1.The ED50 is <500 ng/mL as measured by Balb/3T3 cells, corresponding to a specific activity of >2 × 103 units/mg.
2.Measured in cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts. The ED50 for this effect is < 300 ng/mL in the presence of 10 µg/mL heparin.
-
Measured in cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts. The ED50 for this effect is 170.8 ng/mL, corresponding to a specific activity is 5.85×10^3 units/mg in the presence of 10 µg/mL heparin.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P55075-2 (Q23-R204)
-
Molecular Construction
-
N-term
-
FGF-8a (Q23-R204)
Accession # P55075-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
rHuFGF-8a; AIGF; HBGF-8
-
AA Sequence
QHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
-
Predicted Molecular Mass
21.2 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
