GFRA2/GDNFR-alpha-2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
GFRA2/GDNFR-α-2 protein acts as a receptor for neurotrophic factors and promotes NRTN-induced autophosphorylation and RET receptor activation. It also mediates GDNF signaling through the RET tyrosine kinase receptor. GFRA2/GDNFR-alpha-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GFRA2/GDNFR-α-2 protein acts as a receptor for neurotrophic factors and promotes NRTN-induced autophosphorylation and RET receptor activation. It also mediates GDNF signaling through the RET tyrosine kinase receptor. GFRA2/GDNFR-alpha-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
GFRA2/GDNFR-alpha-2 Protein serves as the receptor for neurturin, facilitating the NRTN-induced autophosphorylation and activation of the RET receptor. Additionally, it plays a role in mediating GDNF signaling through the RET tyrosine kinase receptor. Notably, GFRA2/GDNFR-alpha-2 is involved in the NRTN-induced phosphorylation of STAT3 at 'Ser-727,' highlighting its participation in signaling pathways associated with cell responses. These interactions underscore the significance of GFRA2 in transducing signals that regulate cellular processes and contribute to the intricate network of signaling events involved in neuronal development and maintenance.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Neurturin at 1 μg/mL binds Recombinant Mouse GFR alpha-2/GDNF R alpha-2. The ED50 for this effect is 3.307 nM.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
O08842-1/NP_032141.2 (S22-S441)
-
Molecular Construction
-
N-term
-
Gfra2 (S22-S441)
Accession # O08842/NP_032141.2 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
GFRA2; RET Ligand 2; GDNF Family Receptor Alpha 2; GDNFR-Beta; GDNFRB; NTNR-Alpha; RETL2; Glial Cell Line Derived Neurotrophic Factor Receptor, Beta; TRNR2; PI-Linked Cell-Surface Accessory Protein; GDNF Family Receptor Alpha-2; TRN Receptor, GPI-Anchored
-
AA Sequence
SPSSPQGSELHGWRPQVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYRTITSCPADNYQACLGSYAGMIGFDMTPNYVDSNPTGIVVSPWCNCRGSGNMEEECEKFLKDFTENPCLRNAIQAFGNGTDVNMSPKGPTFSATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSIQEQGLKANNSKELSMCFTELTTNISPGSKKVIKLYS
-
Molecular Weight
Approximately 75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
