1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC chemokine subfamily
  5. GRO-gama/CXCL3 Protein, Human (CHO)

GRO-gama/CXCL3 Protein, Human (CHO)

Cat. No.: HY-P7192
Handling Instructions

GRO-gama/CXCL3 Protein, Human (CHO) mediates its effects on its target cell by interacting with a cell surface chemokine receptor.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

GRO-gama/CXCL3 Protein, Human (CHO) Featured Recommendations:

Top Publications Citing Use of Products

GRO-gama/CXCL3 Protein, Human (CHO) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

CHO

Tag

Tag Free

Accession

P19876 (A35-N107)

Gene ID

2921

Synonyms
rHuGRO-γ/CXCL3; C-X-C motif chemokine 3; MIP2-beta
AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Molecular Weight

Approximately 9 kDa

Biological Activity
The ED50 is <200 ng/mL as measured by CHO-K1/Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells).
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CXCL3 is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3). CXCL3 controls migration and adhesion of monocytes and mediates its effects on its target cell by interacting with a cell surface chemokine receptor called CXCR2[1]. CXCL3 also regulates cell autonomously the migration of the precursors of cerebellar granule neurons toward the internal layers of cerebellum, during the morphogenesis of cerebellum[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRO-gama/CXCL3 Protein, Human (CHO)
Cat. No.:
HY-P7192
Quantity:
MCE Japan Authorized Agent: