GSK3α Protein, Human (Active, sf9, GST)

GSK3B is a protein involved in various cellular processes. It regulates glycogen synthesis, Wnt signaling, apoptosis, autophagy, and neuronal functions. It phosphorylates and deactivates specific proteins, impacting their activity and function in the cell. GSK3α Protein, Human (sf9, GST) is the recombinant human-derived GSK3α protein, expressed by sf9 insect cells , with N-GST labeled tag.

GSK3α protein, a constitutively active kinase, plays a crucial role as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling, and transcription factor and microtubule regulation. It exerts its regulatory function by phosphorylating and inactivating key targets such as glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC, and AXIN1. Primed phosphorylation is a requisite for the majority of its substrates. GSK3α contributes to insulin's control of glycogen synthesis by inhibiting GYS1 activity and thus glycogen synthesis, particularly in the liver. Additionally, it is implicated in the regulation of insulin resistance and plays a role in Wnt signaling by modulating the level and transcriptional activity of nuclear CTNNB1/beta-catenin. GSK3α also participates in amyloid precursor protein (APP) processing associated with Alzheimer's disease, regulates replication in pancreatic beta-cells, and is crucial for the establishment of neuronal polarity and axon outgrowth. Furthermore, it controls cell apoptosis in response to growth factor deprivation, negatively regulates the extrinsic apoptotic signaling pathway, and promotes the formation of an anti-apoptotic complex at death receptors. GSK3α also acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, promoting acetylation of key autophagy regulators. Additionally, it negatively regulates the mTORC2 complex by phosphorylating RICTOR, leading to its ubiquitination and degradation.

The activity of GSK3a protein is determined using the MSA method, which assesses its ability to phosphorylate fluorescent peptides within 30 minutes.

Human

Sf9 insect cells

N-GST

P49840 (S2-S483)

2931

Full Length of Mature Protein

SGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS

Approximately 77.5 kDa

≥ 80%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M trehalose, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.