1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. HB-EGF Protein, Mouse

HB-EGF Protein, Mouse is shown to play a role in wound healing, cardiac hypertrophy, and heart development and function.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

HB-EGF Protein, Mouse is shown to play a role in wound healing, cardiac hypertrophy, and heart development and function.

Background

Heparin-binding epidermal growth factor-like growth factor (HBEGF) is a heparin-binding member of the EGF family. It is a potent mitogen and chemotactic factor for fibroblasts and smooth muscle cells. As with other EGF family members, HB-EGF binds and activates EGF receptors 1 and 4. HB-EGF has been shown to stimulate the growth of a variety of cells in an autocrine or paracrine manner and to be involved in stromal proliferation. HB-EGF is also a potent inducer of tumor growth and angiogenesis[1].

Biological Activity

The ED50 is <1 ng/mL as measured by murine Balb/c 3T3 cells, corresponding to a specific activity of >1.0 × 106IU/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q06186 (D63-L148)

Gene ID
Molecular Construction
N-term
HB-EGF (D63-L148)
Accession # Q06186
C-term
Protein Length

Partial

Synonyms
rMuHB-EGF; Proheparin-binding EGF-like growth factor; HBEGF; DTR
AA Sequence

DLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTL

Predicted Molecular Mass
9.8 kDa
Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM PB, 150 mM NaCl, pH7.4.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM PB, 500 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 10 mM PB, 500 mM NaCl, 8% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

HB-EGF Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HB-EGF Protein, Mouse

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HB-EGF Protein, Mouse
Cat. No.:
HY-P7194
Quantity:
MCE Japan Authorized Agent: