1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Epiregulin
  5. Epiregulin Protein, Mouse (HEK293, hFc)

Epiregulin Protein, a ligand for EGFR and ERBB4, induces their tyrosine phosphorylation, playing a pivotal role in inflammation, wound healing, tissue repair, and oocyte maturation. It regulates angiogenesis, vascular remodeling, and cell proliferation, emphasizing its involvement in intricate cellular signaling pathways. Epiregulin Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived Epiregulin protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Epiregulin Protein, Mouse (HEK293, hFc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Epiregulin Protein, a ligand for EGFR and ERBB4, induces their tyrosine phosphorylation, playing a pivotal role in inflammation, wound healing, tissue repair, and oocyte maturation. It regulates angiogenesis, vascular remodeling, and cell proliferation, emphasizing its involvement in intricate cellular signaling pathways. Epiregulin Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived Epiregulin protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Epiregulin protein serves as a ligand for both the EGF receptor (EGFR) and ERBB4, eliciting the tyrosine phosphorylation of these receptors. This versatile protein plays a pivotal role in various physiological processes, including inflammation, wound healing, tissue repair, and oocyte maturation, exerting its influence through the regulation of angiogenesis, vascular remodeling, and cell proliferation. Its interaction with EGFR and ERBB4 highlights its involvement in intricate cellular signaling pathways.

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells and the ED50 is typically 0.5-2.5 μg/mL.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q61521 (V56-L101)

Gene ID
Molecular Construction
N-term
hFc
Epiregulin (V56-L101)
Accession # Q61521
C-term
Protein Length

Full Length of Epiregulin

Synonyms
Proepiregulin; Epiregulin; EPR; EREG
AA Sequence

VQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFL

Molecular Weight

Approximately 37 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Epiregulin Protein, Mouse (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Epiregulin Protein, Mouse (HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Epiregulin Protein, Mouse (HEK293, hFc)
Cat. No.:
HY-P75226
Quantity:
MCE Japan Authorized Agent: