Epiregulin Protein, Mouse (HEK293, hFc)

Epiregulin Protein, a ligand for EGFR and ERBB4, induces their tyrosine phosphorylation, playing a pivotal role in inflammation, wound healing, tissue repair, and oocyte maturation. It regulates angiogenesis, vascular remodeling, and cell proliferation, emphasizing its involvement in intricate cellular signaling pathways. Epiregulin Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived Epiregulin protein, expressed by HEK293 , with N-hFc labeled tag.

Epiregulin protein serves as a ligand for both the EGF receptor (EGFR) and ERBB4, eliciting the tyrosine phosphorylation of these receptors. This versatile protein plays a pivotal role in various physiological processes, including inflammation, wound healing, tissue repair, and oocyte maturation, exerting its influence through the regulation of angiogenesis, vascular remodeling, and cell proliferation. Its interaction with EGFR and ERBB4 highlights its involvement in intricate cellular signaling pathways.

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells and the ED₅₀ is typically 0.5-2.5 μg/mL.

Mouse

HEK293

N-hFc

Q61521 (V56-L101)

13874  [NCBI]

Full Length of Epiregulin

VQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFL

Approximately 37 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.