Copy Link Print Information

IGF-I/IGF-1 Protein, Mouse

12 Cited Publications
Customer Review

Based on 12 publication(s) in Google Scholar

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • IGF-I/IGF-1 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2].

Background

IGF system has been demonstrated to regulate the growth of numerous tissues, such as neural tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF-I/IGF-1, a key growth factor involved in cell growth, differentiation, survival, and cell cycle regulation, is secreted by mature osteoblasts, stored in the bone matrix, and released during bone resorption. The mitogenic effect of IGF-I/IGF-1 is mediated through its binding to IGF plasma membrane receptors. IGF-I/IGF-1 can stimulate osteoblast proliferation and differentiation, and also promote neuronal survival[1][2].

In Vitro

IGF-I/IGF-1 Protein (Mouse; 1 ng/mL; 6 h) can promote the proliferation of thyroid epithelial cells in in vitro mouse thyroid tissues[3].
IGF-I/IGF-1 Protein (Mouse; 10 nM; 1 h) does not affect the level of PKCδ in H9C2 cells[4].

Verified Bioactivity

1.The ED50 is <10 ng/mL as measured by FDC-P1 cells, corresponding to a specific activity of >1 × 105 units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is ≤9.923 ng/mL. corresponding to a specific activity is ≥1.007×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P05017-1 (G49-A118)

  • Gene ID
    16000  [NCBI]
  • Molecular Construction
    • N-term
    • IGF1 (G49-A118)
      Accession # P05017-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like

  • AA Sequence

    GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

  • Predicted Molecular Mass

    7.7 kDa

  • Molecular Weight

    Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140(10):4699-705. [Content Brief]

[2]. Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35(13):1467-1480. [Content Brief]

[3]. Tian XJ, et al. Regeneration of Thyroid Glands in the Spleen Restores Homeostasis in Thyroidectomy Mice. Adv Sci (Weinh). 2024 Feb;11(6):e2305913. [Content Brief]

[4]. Pan X, et al. Essential Role Of High Glucose-Induced Overexpression Of PKCβ And PKCδ In GLP-1 Resistance In Rodent Cardiomyocytes. Diabetes Metab Syndr Obes. 2019 Nov 4;12:2289-2302. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 9.164 ng/mL. corresponding to a specific activity is 1.03×105 units/mg.

  • 1/16

    IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Customer Validation
     Statistical analysis of tube formation assays of pVICs with exogenous addition of IGF-I/IGF-1 Protein (100 ng/ml) and BMS-536924 during OM induction, and after knockdown of IGF1 expression.

  • 1/16

    IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Customer Validation
     Assessed the changes in protein expression of CDH5, CD31, α-SMA, PI3K, Akt, P-Akt, and HIF-1α in pVICs after the exogenous addition of recombinant IGF-I/IGF-1 Protein (100 ng/ml) and inhibitor BMS-536924 in GM and OM.

  • 1/16

    IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Customer Validation
     Assessed the changes mRNA expression levels of CDH5, CD31, α-SMA, PI3K, Akt, P-Akt, and HIF-1α in pVICs after the exogenous addition of recombinant IGF-I/IGF-1 Protein (100 ng/ml) and inhibitor BMS-536924 in GM and OM.

  • 1/16

    IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Customer Validation
     Tube formation assays in pVICs with exogenous addition of IGF-I/IGF-1 Protein (100 ng/ml) and BMS-536924 during OM induction, and after knockdown of IGF1 expression.

  • 1/16

    IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Feb;11(6):e2305913. [Abstract]

    Customer Validation
     Western blotting analysis of the Cyclin D1 expression in thyroid tissues after co-incubation with spleen homogenate (SH), IGF-I/IGF-1 Protein (1 ng/mL, 6 h), and the inhibitor of the IGF-1 receptor (picropodophyllin, AXL1717).

  • 1/16

    IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Feb;11(6):e2305913. [Abstract]

    Customer Validation
     The proliferative activity of thyroid tissue blocks after co-incubation with spleen homogenate (SH) was determined by EdU staining, comprising soluble components of IGF-I/IGF-1 Protein (1 ng/mL, 6 h), demonstrated their ability to enhance the proliferation of thyroid epithelial cells.2J stain.

  • IGF-I/IGF-1 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Mouse
  • IGF-I/IGF-1 Protein, Mouse Product Image

  • IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Statistical analysis of tube formation assays of pVICs with exogenous addition of IGF-I/IGF-1 Protein (100 ng/ml) and BMS-536924 during OM induction, and after knockdown of IGF1 expression.

  • IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Assessed the changes in protein expression of CDH5, CD31, α-SMA, PI3K, Akt, P-Akt, and HIF-1α in pVICs after the exogenous addition of recombinant IGF-I/IGF-1 Protein (100 ng/ml) and inhibitor BMS-536924 in GM and OM.

  • IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Assessed the changes mRNA expression levels of CDH5, CD31, α-SMA, PI3K, Akt, P-Akt, and HIF-1α in pVICs after the exogenous addition of recombinant IGF-I/IGF-1 Protein (100 ng/ml) and inhibitor BMS-536924 in GM and OM.

  • IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Med. 2025 Nov 3;23(1):600. [Abstract]

    Tube formation assays in pVICs with exogenous addition of IGF-I/IGF-1 Protein (100 ng/ml) and BMS-536924 during OM induction, and after knockdown of IGF1 expression.

  • IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Feb;11(6):e2305913. [Abstract]

    Western blotting analysis of the Cyclin D1 expression in thyroid tissues after co-incubation with spleen homogenate (SH), IGF-I/IGF-1 Protein (1 ng/mL, 6 h), and the inhibitor of the IGF-1 receptor (picropodophyllin, AXL1717).

  • IGF-I/IGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Feb;11(6):e2305913. [Abstract]

    The proliferative activity of thyroid tissue blocks after co-incubation with spleen homogenate (SH) was determined by EdU staining, comprising soluble components of IGF-I/IGF-1 Protein (1 ng/mL, 6 h), demonstrated their ability to enhance the proliferation of thyroid epithelial cells.2J stain.