IL-12 beta Protein, Mouse (HEK293, His)

IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer^[1]. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT^[3]. IL-12 beta Protein consists of 335 amino acids (M1-S335) with a fibronectin type-III domain (233-324 a.a). IL-12 beta Protein, Mouse (M23-S335) is produced in HEK293 cells with a C-Terminal His-tag.

IL-12 beta Protein, as known as IL12 p40 subunit or IL-12B, heterodimerizes with the IL-12 p35 subunit (IL-12A) to form IL-12 and with the IL23 p19 subunit to form IL-23, exerting different regulating functions^[1].
IL-12 and IL23 belong to IL-12 family, are involved in proinflammatory responses and expressed by activated macrophages that serve as an essential inducer of Th1 cells development^[2].
IL-12 signals via IL-12Rβ1 and IL-12Rβ2 mediated by p-STAT4, whereas IL-23 signals via IL-12Rβ1 and IL-23R mediated by p-STAT1 and p-STAT3^[3].
The sequence of amino acids in IL-12 beta proteins of mouse is very different from human (69.04%), but shows high similarity with rat (92.24%).
Interleukin 12 (IL-12) family have been known to be inflammatory factors, induce autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis^[4].

Mouse IL-12 (mIL-12) has a significant stimulating effect on CTLL-2 cells and results 65-70% of CTLL2 cell population having mIL12 receptors^[5].
Mouse IL-12 (mIL-12) (0.19-50 U/mL; 24-72 h) inhibits CTLL-2 cells proliferation without cell-lethal effect at 2 U/mL for 72 h^[5].

IL12b^-/- (p40-deficient) mice exhibits decreasing blood neutrophil numbers and an absence of serum levels of IL-17A^[6].
  IL12b^-/-/Itgb2^-/- (lacking adhesion molecules like beta2-integrins) mice has a reducing tissue mRNA expression of IL-17A compared with Itgb2^-/- controls and reduces total number of CD3+ IL-17A-producing Tn cells in the spleen and lamina propria^[6].
IL12b contributes to Aβ₄₂-induced neuronal damage and cognitive decline in APPPS1 Alzheimer's disease mouse model^[7].

Immobilized IL-12 R beta 1 at 5 μg/mL (100 μL/well) can bind biotinylated Mouse IL-12 beta. The ED₅₀ for this effect is 30.91 ng/mL.

• 
  Immobilized IL-12 R beta 1 at 5 μg/mL (100 μL/well) can bind biotinylated Mouse IL-12 beta .The ED₅₀ for this effect is 30.91 ng/mL.

Mouse

HEK293

C-6*His

P43432 (M23-S335)

16160  [NCBI]

Full Length of Mature Protein

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Approximately 42-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Lu X. Impact of IL-12 in Cancer. Curr Cancer Drug Targets. 2017;17(8):682-697.  [Content Brief]

  [2]. Gunsten S, et al. IL-12 p80-dependent macrophage recruitment primes the host for increased survival following a lethal respiratory viral infection. Immunology. 2009 Apr;126(4):500-13.  [Content Brief]

  [3]. Gotthardt D, Trifinopoulos J, Sexl V, Putz EM. JAK/STAT Cytokine Signaling at the Crossroad of NK Cell Development and Maturation. Front Immunol. 2019 Nov 12;10:2590.  [Content Brief]

  [4]. Tait Wojno ED, Hunter CA, Stumhofer JS. The Immunobiology of the Interleukin-12 Family: Room for Discovery. Immunity. 2019 Apr 16;50(4):851-870.  [Content Brief]

  [5]. Khatri A, et al. Murine CTLL-2 cells respond to mIL12: prospects for developing an alternative bioassay for measurement of murine cytokines IL12 and IL18. J Immunol Methods. 2007 Sep 30;326(1-2):41-53.  [Content Brief]

  [6]. Smith E, et al. IL-23 is required for neutrophil homeostasis in normal and neutrophilic mice. J Immunol. 2007 Dec 15;179(12):8274-9.  [Content Brief]

  [7]. Vom Berg J, et al. Inhibition of IL-12/IL-23 signaling reduces Alzheimer's disease-like pathology and cognitive decline. Nat Med. 2012 Dec;18(12):1812-9.  [Content Brief]