IL-12 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-12 protein forms IL-12 cytokine and IL-35 cytokine. It regulates T cell and natural killer cell responses, stimulates interferon gamma production, and promotes T helper 1 cell differentiation. IL-12 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-12 protein, expressed by HEK293 , with C-6*His labeled tag. IL-12 Protein, Rat (HEK293, His), has molecular weight of 25-35 & 40-50 kDa, respectively.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-12 protein forms IL-12 cytokine and IL-35 cytokine. It regulates T cell and natural killer cell responses, stimulates interferon gamma production, and promotes T helper 1 cell differentiation. IL-12 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-12 protein, expressed by HEK293 , with C-6*His labeled tag. IL-12 Protein, Rat (HEK293, His), has molecular weight of 25-35 & 40-50 kDa, respectively.

Background

The IL-12 Protein has the ability to heterodimerize with IL12B to form the IL-12 cytokine, or with EBI3/IL27B to form the IL-35 cytokine. It is primarily produced by professional antigen-presenting cells such as B-cells, dendritic cells, macrophages, and granulocytes, and plays a crucial role in regulating T-cell and natural killer-cell responses. IL-12 stimulates the production of interferon-gamma and promotes the differentiation of T-helper 1 cells, bridging the gap between innate resistance and adaptive immunity. Its biological effects are mediated through a receptor composed of IL12R1 and IL12R2 subunits, leading to the phosphorylation of cellular substrates including TYK2 and JAK2. This, in turn, activates STAT4 and facilitates the regulation of cytokine/growth factor responsive genes. In the context of IL-35, IL-12 Protein contributes to maintaining immune homeostasis in the liver microenvironment and acts as an immune-suppressive cytokine. Its signaling occurs through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers, and requires the involvement of transcription factors STAT1 and STAT4. Furthermore, IL-12 Protein can form a disulfide-linked heterodimer with IL12B, known as interleukin IL-12, and a non-disulfide-linked heterodimer with EBI3/IL27B, known as interleukin IL-35. Additionally, it interacts with NBR1, promoting the secretion of IL-12.

Verified Bioactivity

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.4193 μg/mL, corresponding to a specific activity is 2384.927 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.4193 μg/mL. corresponding to a specific activity is 2384.927 units/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL12B (M23-S335)
      Accession # Q9R278
    • C-term
    • N-term
    • IL12A (R23-S215)
      Accession # Q9R103
    • 6*His
    • C-term
  • Synonyms

    IL12A; Cytotoxic Lymphocyte Maturation Factor 1, P35; Prev. NKSF1; NK Cell Stimulatory Factor Chain 1; IL-12A; Interleukin-12 Alpha Chain; Interleukin-12 Subunit Alpha; Interleukin 12, P35; CLMF; IL-12, Subunit P35; NFSK; IL35 Subunit; P35; CLMF P35; Inte

  • AA Sequence

    MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS&RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS

  • Predicted Molecular Mass

    36.7 kDa & 22.6 kDa

  • Molecular Weight

    Approximately 25-35 kDa & 40-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00