IL-20R alpha Protein, Human (HEK293, His)

IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26[3]. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

Background

IL-20R alpha, also known as a alpha subunit of IL-20 receptor (IL-20RA), belongs to the type II cytokine receptor family[1].
IL-20R alpha is widely expressed with highest levels in skin and testis and high levels in brain[2].
IL20RA and IL20RB is found to be upregulated in psoriatic skin lesions on keratinocytes[3].
IL-20R alpha forms functional heterodimers with different subunit protein. IL-20R alpha serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RB, however serves as the receptor for IL-26 by dimerizing with IL-10RB. IL-20R alpha transduces ligand-binding at least in part through STAT3 activation, and plays an important role in epidermal function and psoriasis[4].
The sequence of amino acids in IL-12 beta proteins of human is very different from mouse (64.64%).

In Vitro

IL-20 receptor mRNA is decreased in psoriasis, and shows high protein level in mononuclear leukocytes in the papillary dermis and along the dermoepidermal junction[4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-20Rα (V30-K250)
      Accession # Q9UHF4-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL20RA; IL-20RA; Interleukin 20 Receptor Subunit Alpha; CRF2-8; IL-20R1; Interleukin 20 Receptor, Alpha, Isoform CRA_b; Interleukin 20 Receptor Alpha Subunit; Cytokine Receptor Class-II Member 8; Interleukin-20 Receptor Subunit Alpha; Class II Cytokine Re

  • AA Sequence

    VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

  • Predicted Molecular Mass

    26.3 kDa

  • Molecular Weight

    Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00