IL-20R alpha Protein, Human (HEK293, His)
IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.
- Species: Human
- Source: HEK293
-
보관:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Biological Activity
-
Technical Parameters
-
Product Properties
- 각종 서류
- References
- Help & FAQs
Biological Activity
IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26[3]. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.
IL-20R alpha, also known as a alpha subunit of IL-20 receptor (IL-20RA), belongs to the type II cytokine receptor family[1].
IL-20R alpha is widely expressed with highest levels in skin and testis and high levels in brain[2].
IL20RA and IL20RB is found to be upregulated in psoriatic skin lesions on keratinocytes[3].
IL-20R alpha forms functional heterodimers with different subunit protein. IL-20R alpha serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RB, however serves as the receptor for IL-26 by dimerizing with IL-10RB. IL-20R alpha transduces ligand-binding at least in part through STAT3 activation, and plays an important role in epidermal function and psoriasis[4].
The sequence of amino acids in IL-12 beta proteins of human is very different from mouse (64.64%).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9UHF4-1 (V30-K250)
-
Molecular Construction
-
N-term
-
IL-20Rα (V30-K250)
Accession # Q9UHF4-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Interleukin-20 receptor subunit alpha; IL-20R-alpha; IL-20RA; CRF2-8; IL-20R1; ZcytoR7
-
AA Sequence
VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
-
Predicted Molecular Mass
26.3 kDa
-
분자량
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
각종 서류
References
[1]. Wang F, et al. Prominent production of IL-20 by CD68+/CD11c+ myeloid-derived cells in psoriasis: Gene regulation and cellular effects. J Invest Dermatol. 2006 Jul;126(7):1590-9. [Content Brief]
[2]. Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;104(1):9-19. [Content Brief]
[3]. Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172(4):2006-10. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
