IL-20R beta Protein, Human (sf9, His)
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24. IL-20R beta Protein is consists of 311 amino acids (M1-S311) with a transmembrane domain (234-254 a.a.). IL-20R beta Protein, Human (sf9, His) is produced in Sf9 insect cells with a C-Terminal His-tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 311 amino acids (M1-S311) with a transmembrane domain (234-254 a.a.). IL-20R beta Protein, Human (sf9, His) is produced in Sf9 insect cells with a C-Terminal His-tag.
Background
IL-20R beta (IL-12RB), also known as a beta subunit of IL-20 receptor (IL-20RB), belongs to the type II cytokine receptor family. IL-20R beta is widely expressed with highest levels in skin and testis and highly expressed in psoriatic skin[1].
IL-20R beta forms functional heterodimers with different subunit protein. IL-20R beta serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RA, however serves as the receptor for IL-20 and IL-24 by dimerizing with IL-22RA1[2].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1, act function by binding IL-20, and then stimulates a signal transduction pathway through STAT3 in a keratinocyte cell line[1].
However, the expression of both IL-20RB/IL-20RA is found to be upregulated in psoriatic skin lesions on keratinocytes[3].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1 bind to IL-24, induce rapid activation of Stat-1 and Stat-3 transcription factors, which appear to play a role in cell survival and proliferation[4].
The sequence of amino acids in IL-12 beta proteins of human is very different from mouse (64.64%).
In Vitro
IL-2R beta involves in making up IL-2 II cytokine heterodimeric receptor type 1 (IL-2RB/IL-2RA) and type 2 (IL-2RB/IL-22RA1), thus binds to MDA-7 protein, encoded by melanoma differentiation-associated gene-7 (mda-7/IL24)[5].
Both type 1 and type 2 IL-2R binds to MDA-7 protein and induces phosphorylation and nuclear translocation of STAT3 in melanoma cells, also induces dose-dependent cell death in melanoma tumor cells, results in up-regulation of BAX and subsequent apoptosis induction[5].
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q6UXL0-1 (D30-A230)
-
Molecular Construction
-
N-term
-
IL-2Rβ (D3-A23)
Accession # Q6UXL-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL20RB; Interleukin-20 Receptor Subunit Beta; Prev. FNDC6; IL-20R-Beta; IL-20R2; MGC34923; DIRS1; IL-20RB; Fibronectin Type III Domain Containing 6; Interleukin 20 Receptor Beta; Interleukin 20 Receptor Beta Subunit; Interleukin-20 Receptor II; Interleuki
-
AA Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
-
Predicted Molecular Mass
23.9 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;10 4(1):9-19. [Content Brief]
[2]. Wegenka UM. IL-20: biological functions mediated through two types of receptor complexes. Cytokine Growth Factor Rev. 2010 Oct;21(5):353-63. [Content Brief]
[3]. Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172(4):2006-10. [Content Brief]
[4]. Wang M, et al. Interleukin-24 and its receptors. Immunology. 2005 Feb;114(2):166-70. [Content Brief]
[5]. Chada S, et al. Bystander activity of Ad-mda7: human MDA-7 protein kills melanoma cells via an IL-20 receptor-dependent but STAT3-independent mechanism. Mol Ther. 2004 Dec;10(6):1085-95. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
