1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-23
  5. IL-23 alpha
  6. IL-23 alpha Protein, Human (HEK293, Fc)

IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. IL-23 alpha Protein, Human (HEK293, Fc) is the recombinant human-derived IL-23 alpha protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 해외재고보유
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 견적 받기
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. IL-23 alpha Protein, Human (HEK293, Fc) is the recombinant human-derived IL-23 alpha protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IL-23, in collaboration with IL12B, forms the pro-inflammatory cytokine IL-23, playing diverse roles in both innate and adaptive immunity. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to a heterodimeric receptor complex comprising IL12RB1 and IL23R, initiating a cascade involving JAK2 and TYK2 activation. These kinases phosphorylate the receptor, creating a docking site for the subsequent phosphorylation of STAT3 and STAT4. This process activates multiple pathways, including p38 MAPK or NF-kappa-B, fostering the production of pro-inflammatory cytokines, such as interleukin-17A/IL17A. Additionally, IL-23 actively participates in the early and effective clearance of intracellular bacteria. Notably, IL-23 promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, alongside other IL-17-producing cells. The heterodimeric association of IL-23 with IL12B, known as interleukin IL-23, is disulfide-linked. Furthermore, IL-23 interacts with IL23R, facilitating the recruitment of IL12RB1.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9NPF7 (R20-P189)

Gene ID
Molecular Construction
N-term
IL-23α (R20-P189)
Accession # Q9NPF7
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; SGRF; IL-23p19
AA Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Predicted Molecular Mass
45.4 kDa
분자량

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 85%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

IL-23 alpha Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-23 alpha Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-23 alpha Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76432
수량:
MCE Japan Authorized Agent: