IL-31 Protein, Canine (HEK293, His)
Based on 1 Customer Validation
IL-31 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-31 protein, expressed by HEK293, with N-His tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-31 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-31 protein, expressed by HEK293, with N-His tag.
Background
IL-31, a cytokine with diverse functions, acts by activating STAT3, and potentially STAT1 and STAT5, utilizing the IL-31 heterodimeric receptor formed by IL31RA and OSMR. This activation mechanism has been implicated in skin immunity, highlighting its role in modulating immune responses. Additionally, IL-31 exhibits the capacity to enhance myeloid progenitor cell survival in vitro, emphasizing its involvement in cellular processes beyond immune regulation. Furthermore, IL-31 induces the expression of key genes, such as RETNLA and serum amyloid A protein, in macrophages, suggesting a broader impact on inflammatory and immune-related pathways.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag N-8*His
-
Accession
BAH97742 (A27-Q159)
-
Gene ID256353430
-
Protein Length
Partial
-
Synonyms
IL31; IL-31; Interleukin 31; Interleukin-31
-
AA Sequence
APTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
-
Predicted Molecular Mass
16.6 kDa
-
Molecular Weight
Approximately 26-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
