IL-31 Protein, Canine (HEK293, His)

IL-31 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-31 protein, expressed by HEK293, with N-His tag.

IL-31, a cytokine with diverse functions, acts by activating STAT3, and potentially STAT1 and STAT5, utilizing the IL-31 heterodimeric receptor formed by IL31RA and OSMR. This activation mechanism has been implicated in skin immunity, highlighting its role in modulating immune responses. Additionally, IL-31 exhibits the capacity to enhance myeloid progenitor cell survival in vitro, emphasizing its involvement in cellular processes beyond immune regulation. Furthermore, IL-31 induces the expression of key genes, such as RETNLA and serum amyloid A protein, in macrophages, suggesting a broader impact on inflammatory and immune-related pathways.

Canine

HEK293

N-8*His

BAH97742 (A27-Q159)

256353430

Partial

APTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ

Approximately 26-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.