KGF-2/FGF-10 Protein, Human (169a.a)

KGF-2/FGF-10 Protein, Human (159a.a) is a heparin-binding protein that binds to FGF2 IIIb and FGFR1III-b receptors, promotes the growth, proliferation, and differentiation of epithelial cells and can enhance corneal wound healing.

Keratinocyte growth factor-2 (KGF-2), also called fibroblast growth factor-10 (FGF-10), is a soluble 170-amino-acid polypeptide secreted by fibroblasts and endothelial cells acting primarily on epithelial cells. Its functions mainly mediated by FGF-2 IIIb receptor, a transmembrane receptor, expressed exclusively by epithelial cells. KGF-2 promotes the growth, proliferation, and differentiation of epithelial cells, with promising effects in treating epithelial damage. KGF-2 enhances corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury^[1]. Keratinocyte growth factor-2 (KGF-2) is a 20-kD heparin-binding protein, and also binds to FGFR1III-b, which may explain the severely impaired lung development of FGF-10 null mice^[2].

Human

E. coli

Tag Free

O15520 (L40-S208)

2255  [NCBI]

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Approximately 19.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cai J, et al. Pharmacokinetics of topically applied recombinant human keratinocyte growth factor-2 in alkali-burned and intact rabbit eye. Exp Eye Res. 2015 Jul;136:93-9.  [Content Brief]

  [2]. Bi J, et al. Keratinocyte growth factor-2 intratracheal instillation significantly attenuates ventilator-induced lung injury in rats. J Cell Mol Med. 2014 Jun;18(6):1226-35.  [Content Brief]