KGF-2/FGF-10 Protein, Human (169a.a)

KGF-2/FGF-10 Protein, Human (169a.a) is a heparin-binding protein that binds to FGF2 IIIb and FGFR1III-b receptors, promotes the growth, proliferation, and differentiation of epithelial cells and can enhance corneal wound healing.

Keratinocyte growth factor-2 (KGF-2), also called fibroblast growth factor-10 (FGF-10), is a soluble 170-amino-acid polypeptide secreted by fibroblasts and endothelial cells acting primarily on epithelial cells. Its functions mainly mediated by FGF-2 IIIb receptor, a transmembrane receptor, expressed exclusively by epithelial cells. KGF-2 promotes the growth, proliferation, and differentiation of epithelial cells, with promising effects in treating epithelial damage. KGF-2 enhances corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury^[1]. Keratinocyte growth factor-2 (KGF-2) is a 20-kD heparin-binding protein, and also binds to FGFR1III-b, which may explain the severely impaired lung development of FGF-10 null mice^[2].

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is ≤84.07 ng/mL, corresponding to a specificactivity is ≥1.2×10⁴ Unit/mg.

• 
  Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is 35.64 ng/mL, corresponding to a specificactivity is 2.806×10⁴ Unit/mg.

Human

E. coli

Tag Free

O15520 (L40-S208)

2255  [NCBI]

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

19-22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or10 mM Tris, 5% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cai J, et al. Pharmacokinetics of topically applied recombinant human keratinocyte growth factor-2 in alkali-burned and intact rabbit eye. Exp Eye Res. 2015 Jul;136:93-9.  [Content Brief]

  [2]. Bi J, et al. Keratinocyte growth factor-2 intratracheal instillation significantly attenuates ventilator-induced lung injury in rats. J Cell Mol Med. 2014 Jun;18(6):1226-35.  [Content Brief]