LIMK1 Protein, Human (sf9, His-GST)

The LIMK1 protein is an important serine/threonine protein kinase that controls actin dynamics downstream of Rho GTPases. Activation of ROCK1, PAK1, and PAK4 phosphorylates LIMK1, allowing it to phosphorylate and inhibit actin depolymerizing factors, including cofilin-1/CFL1 and destrin/DSTN. LIMK1, Human (sf9, His-GST) is the recombinant human-derived LIMK1 protein, expressed by sf9 insect cells, with N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The LIMK1 protein is an important serine/threonine protein kinase that controls actin dynamics downstream of Rho GTPases. Activation of ROCK1, PAK1, and PAK4 phosphorylates LIMK1, allowing it to phosphorylate and inhibit actin depolymerizing factors, including cofilin-1/CFL1 and destrin/DSTN. LIMK1, Human (sf9, His-GST) is the recombinant human-derived LIMK1 protein, expressed by sf9 insect cells, with N-Avi labeled tag.

Background

LIMK1 Protein, a serine/threonine-protein kinase, plays a vital role in regulating actin filament dynamics, acting downstream of various Rho family GTPase signal transduction pathways. Activation of LIMK1 is mediated by upstream kinases, including ROCK1, PAK1, and PAK4, which phosphorylate a threonine residue in its activation loop. Subsequently, LIMK1 phosphorylates and inactivates actin-binding/depolymerizing factors such as cofilin-1/CFL1, cofilin-2/CFL2, and destrin/DSTN, preventing the cleavage of filamentous actin (F-actin) and stabilizing the actin cytoskeleton. This regulation influences diverse actin-dependent processes, including cell motility, cell cycle progression, and differentiation. Additionally, LIMK1 phosphorylates TPPP on serine residues, promoting microtubule disassembly and stimulating axonal outgrowth, potentially contributing to brain development. Notably, LIMK1 has a dominant negative effect on actin cytoskeletal changes and is crucial for the atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).

Technical Parameters

  • Species Human
  • Source sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • (G285-G638)
      Accession # P53667-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LIMK1; LIMK-1; LIM Domain Kinase 1; LIM Motif-Containing Protein Kinase; LIMK; Uncharacterized Protein LIMK1

  • AA Sequence

    GSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESG

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipped with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00