LIMK1 Protein, Human (sf9, His-GST)
The LIMK1 protein is an important serine/threonine protein kinase that controls actin dynamics downstream of Rho GTPases. Activation of ROCK1, PAK1, and PAK4 phosphorylates LIMK1, allowing it to phosphorylate and inhibit actin depolymerizing factors, including cofilin-1/CFL1 and destrin/DSTN. LIMK1, Human (sf9, His-GST) is the recombinant human-derived LIMK1 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The LIMK1 protein is an important serine/threonine protein kinase that controls actin dynamics downstream of Rho GTPases. Activation of ROCK1, PAK1, and PAK4 phosphorylates LIMK1, allowing it to phosphorylate and inhibit actin depolymerizing factors, including cofilin-1/CFL1 and destrin/DSTN. LIMK1, Human (sf9, His-GST) is the recombinant human-derived LIMK1 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
LIMK1 Protein, a serine/threonine-protein kinase, plays a vital role in regulating actin filament dynamics, acting downstream of various Rho family GTPase signal transduction pathways. Activation of LIMK1 is mediated by upstream kinases, including ROCK1, PAK1, and PAK4, which phosphorylate a threonine residue in its activation loop. Subsequently, LIMK1 phosphorylates and inactivates actin-binding/depolymerizing factors such as cofilin-1/CFL1, cofilin-2/CFL2, and destrin/DSTN, preventing the cleavage of filamentous actin (F-actin) and stabilizing the actin cytoskeleton. This regulation influences diverse actin-dependent processes, including cell motility, cell cycle progression, and differentiation. Additionally, LIMK1 phosphorylates TPPP on serine residues, promoting microtubule disassembly and stimulating axonal outgrowth, potentially contributing to brain development. Notably, LIMK1 has a dominant negative effect on actin cytoskeletal changes and is crucial for the atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P53667-1 (G285-G638)
-
Gene ID3984
-
Molecular Construction
-
N-term
-
His-GST
-
(G285-G638)
Accession # P53667-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
LIMK1; LIMK-1; LIM Domain Kinase 1; LIM Motif-Containing Protein Kinase; LIMK; Uncharacterized Protein LIMK1
-
AA Sequence
GSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESG
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)