1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins TKL
  4. LISK
  5. LIMK1
  6. LIMK1 Protein, Human (D460N, sf9)

The LIMK1 protein is an important serine/threonine protein kinase that controls actin dynamics downstream of Rho GTPases. Activation of ROCK1, PAK1, and PAK4 phosphorylates LIMK1, allowing it to phosphorylate and inhibit actin depolymerizing factors, including cofilin-1/CFL1 and destrin/DSTN. LIMK1 Protein, Human (D460N, sf9) is the recombinant human-derived LIMK1 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LIMK1 protein is an important serine/threonine protein kinase that controls actin dynamics downstream of Rho GTPases. Activation of ROCK1, PAK1, and PAK4 phosphorylates LIMK1, allowing it to phosphorylate and inhibit actin depolymerizing factors, including cofilin-1/CFL1 and destrin/DSTN. LIMK1 Protein, Human (D460N, sf9) is the recombinant human-derived LIMK1 protein, expressed by sf9 insect cells , with tag free.

Background

LIMK1 Protein, a serine/threonine-protein kinase, plays a vital role in regulating actin filament dynamics, acting downstream of various Rho family GTPase signal transduction pathways. Activation of LIMK1 is mediated by upstream kinases, including ROCK1, PAK1, and PAK4, which phosphorylate a threonine residue in its activation loop. Subsequently, LIMK1 phosphorylates and inactivates actin-binding/depolymerizing factors such as cofilin-1/CFL1, cofilin-2/CFL2, and destrin/DSTN, preventing the cleavage of filamentous actin (F-actin) and stabilizing the actin cytoskeleton. This regulation influences diverse actin-dependent processes, including cell motility, cell cycle progression, and differentiation. Additionally, LIMK1 phosphorylates TPPP on serine residues, promoting microtubule disassembly and stimulating axonal outgrowth, potentially contributing to brain development. Notably, LIMK1 has a dominant negative effect on actin cytoskeletal changes and is crucial for the atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

P53667 (R329-G638, D460N)

Gene ID

3984

Molecular Construction
N-term
LIMK1 (R329-G638, D460N)
Accession # P53667
C-term
Protein Length

Partial

Synonyms
LIMK1; LIM domain kinase 1; LIMK-1
AA Sequence

RPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRNLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESG

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LIMK1 Protein, Human (D460N, sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIMK1 Protein, Human (D460N, sf9)
Cat. No.:
HY-P701792
Quantity:
MCE Japan Authorized Agent: