1. Recombinant Proteins
  2. Others
  3. MYD88 Protein, Human (His, GST)

The MYD88 protein is a key adapter in Toll-like receptor (TLR) and IL-1 receptor signaling and can activate NF-kappa-B, cytokine secretion and inflammatory responses through IRAK1, IRAK2, IRF7 and TRAF6. It enhances IL-8 transcription and participates in IL-18-mediated pathways. MYD88 Protein, Human (His, GST) is the recombinant human-derived MYD88 protein, expressed by E. coli , with N-6*His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MYD88 protein is a key adapter in Toll-like receptor (TLR) and IL-1 receptor signaling and can activate NF-kappa-B, cytokine secretion and inflammatory responses through IRAK1, IRAK2, IRF7 and TRAF6. It enhances IL-8 transcription and participates in IL-18-mediated pathways. MYD88 Protein, Human (His, GST) is the recombinant human-derived MYD88 protein, expressed by E. coli , with N-6*His, N-GST labeled tag.

Background

The MYD88 protein functions as an adapter protein crucial in the Toll-like receptor (TLR) and IL-1 receptor signaling pathways within the innate immune response. Acting through IRAK1, IRAK2, IRF7, and TRAF6, MYD88 triggers NF-kappa-B activation, cytokine secretion, and an inflammatory response. Additionally, it enhances IL-8 transcription and participates in the IL-18-mediated signaling pathway. MYD88 activates IRF1, facilitating its swift translocation into the nucleus to efficiently induce IFN-beta, NOS2/INOS, and IL12A genes. Notably, upon TLR8 activation by GU-rich single-stranded RNA from viruses like SARS-CoV-2, SARS-CoV, and HIV-1, MYD88 induces IL1B release through NLRP3 inflammasome activation. In intestinal epithelial cells, MYD88-mediated signaling is pivotal for maintaining gut homeostasis and regulating the expression of the antimicrobial lectin REG3G in the small intestine. MYD88 forms homodimers and heterodimers with TIRAP, binds to TLR2, TLR4, TLR5, IRAK1, IRAK2, IRAK4, and interacts with various proteins, including IL18R1, BMX, IL1RL1, IKBKE, IRF7, LRRFIP1, LRRFIP2, FLII, IRF1, PELI1, and DHX9, among others, thereby orchestrating a complex network of molecular interactions involved in diverse signaling pathways.

Species

Human

Source

E. coli

Tag

N-6*His;N-GST

Accession

Q99836 (M157-P296)

Gene ID

4615

Molecular Construction
N-term
6*His-GST
MYD88 (M157-P296)
Accession # Q99836
C-term
Protein Length

Partial

Synonyms
MYD88; Myeloid differentiation primary response protein MyD88
AA Sequence

MPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Molecular Weight

44.2 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES pH 7.0, 200 or 250 mM NaCl, 1 mM TCEP, 20% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MYD88 Protein, Human (His, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MYD88 Protein, Human (His, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MYD88 Protein, Human (His, GST)
Cat. No.:
HY-P702057
Quantity:
MCE Japan Authorized Agent: