MYD88 Protein, Human (His, GST)
Based on 1 Customer Validation
The MYD88 protein is a key adapter in Toll-like receptor (TLR) and IL-1 receptor signaling and can activate NF-kappa-B, cytokine secretion and inflammatory responses through IRAK1, IRAK2, IRF7 and TRAF6. It enhances IL-8 transcription and participates in IL-18-mediated pathways. MYD88 Protein, Human (His, GST) is the recombinant human-derived MYD88 protein, expressed by E. coli , with N-6*His, N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The MYD88 protein is a key adapter in Toll-like receptor (TLR) and IL-1 receptor signaling and can activate NF-kappa-B, cytokine secretion and inflammatory responses through IRAK1, IRAK2, IRF7 and TRAF6. It enhances IL-8 transcription and participates in IL-18-mediated pathways. MYD88 Protein, Human (His, GST) is the recombinant human-derived MYD88 protein, expressed by E. coli , with N-6*His, N-GST labeled tag.
Background
The MYD88 protein functions as an adapter protein crucial in the Toll-like receptor (TLR) and IL-1 receptor signaling pathways within the innate immune response. Acting through IRAK1, IRAK2, IRF7, and TRAF6, MYD88 triggers NF-kappa-B activation, cytokine secretion, and an inflammatory response. Additionally, it enhances IL-8 transcription and participates in the IL-18-mediated signaling pathway. MYD88 activates IRF1, facilitating its swift translocation into the nucleus to efficiently induce IFN-beta, NOS2/INOS, and IL12A genes. Notably, upon TLR8 activation by GU-rich single-stranded RNA from viruses like SARS-CoV-2, SARS-CoV, and HIV-1, MYD88 induces IL1B release through NLRP3 inflammasome activation. In intestinal epithelial cells, MYD88-mediated signaling is pivotal for maintaining gut homeostasis and regulating the expression of the antimicrobial lectin REG3G in the small intestine. MYD88 forms homodimers and heterodimers with TIRAP, binds to TLR2, TLR4, TLR5, IRAK1, IRAK2, IRAK4, and interacts with various proteins, including IL18R1, BMX, IL1RL1, IKBKE, IRF7, LRRFIP1, LRRFIP2, FLII, IRF1, PELI1, and DHX9, among others, thereby orchestrating a complex network of molecular interactions involved in diverse signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-GST
-
Accession
Q99836 (M157-P296)
-
Gene ID4615
-
Molecular Construction
-
N-term
-
6*His-GST
-
MYD88 (M157-P296)
Accession # Q99836 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MYD88; Mutant Myeloid Differentiation Primary Response 88; MYD88 Innate Immune Signal Transduction Adaptor; TLR Adaptor MYD88; Myeloid Differentiation Primary Response Protein MyD88; MYD88D; Myeloid Differentiation Primary Response 88; IMD68; Myeloid Diff
-
AA Sequence
MPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
-
Predicted Molecular Mass
44.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES pH 7.0, 200 or 250 mM NaCl, 1 mM TCEP, 20% glycerol.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)