MYD88 Protein, Human

Customer Review

Based on 1 Customer Validation

The MYD88 protein is a key adapter in Toll-like receptor (TLR) and IL-1 receptor signaling and can activate NF-kappa-B, cytokine secretion and inflammatory responses through IRAK1, IRAK2, IRF7 and TRAF6. It enhances IL-8 transcription and participates in IL-18-mediated pathways. MYD88 Protein, Human is the recombinant human-derived MYD88 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MYD88 protein is a key adapter in Toll-like receptor (TLR) and IL-1 receptor signaling and can activate NF-kappa-B, cytokine secretion and inflammatory responses through IRAK1, IRAK2, IRF7 and TRAF6. It enhances IL-8 transcription and participates in IL-18-mediated pathways. MYD88 Protein, Human is the recombinant human-derived MYD88 protein, expressed by E. coli , with tag free.

Background

The MYD88 protein functions as an adapter protein crucial in the Toll-like receptor (TLR) and IL-1 receptor signaling pathways within the innate immune response. Acting through IRAK1, IRAK2, IRF7, and TRAF6, MYD88 triggers NF-kappa-B activation, cytokine secretion, and an inflammatory response. Additionally, it enhances IL-8 transcription and participates in the IL-18-mediated signaling pathway. MYD88 activates IRF1, facilitating its swift translocation into the nucleus to efficiently induce IFN-beta, NOS2/INOS, and IL12A genes. Notably, upon TLR8 activation by GU-rich single-stranded RNA from viruses like SARS-CoV-2, SARS-CoV, and HIV-1, MYD88 induces IL1B release through NLRP3 inflammasome activation. In intestinal epithelial cells, MYD88-mediated signaling is pivotal for maintaining gut homeostasis and regulating the expression of the antimicrobial lectin REG3G in the small intestine. MYD88 forms homodimers and heterodimers with TIRAP, binds to TLR2, TLR4, TLR5, IRAK1, IRAK2, IRAK4, and interacts with various proteins, including IL18R1, BMX, IL1RL1, IKBKE, IRF7, LRRFIP1, LRRFIP2, FLII, IRF1, PELI1, and DHX9, among others, thereby orchestrating a complex network of molecular interactions involved in diverse signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MYD88 (M157-P296)
      Accession # Q99836
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MYD88; Mutant Myeloid Differentiation Primary Response 88; MYD88 Innate Immune Signal Transduction Adaptor; TLR Adaptor MYD88; Myeloid Differentiation Primary Response Protein MyD88; MYD88D; Myeloid Differentiation Primary Response 88; IMD68; Myeloid Diff

  • AA Sequence

    MPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol or 50 mM Tris-HCl (pH 7.5), 200 mM NaCl, 20% glycerol, 1 mM DTT .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00