PARP14 Protein, Human (His, StrepⅡ)
The PARP14 protein is an ADP-ribosyltransferase that uniquely mono-ADP-ribosylates glutamic acid residues on target proteins such as STAT1 and STAT6, unlike PARP1 and PARP2. It catalyzes STAT1 mono-ADP ribosylation at “Glu-657” and “Glu-705”, reduces STAT1 phosphorylation and inhibits the production of pro-inflammatory cytokines in macrophages following IFNG stimulation. PARP14 Protein, Human (His, Strep) is the recombinant human-derived PARP14 protein, expressed by E. coli , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PARP14 protein is an ADP-ribosyltransferase that uniquely mono-ADP-ribosylates glutamic acid residues on target proteins such as STAT1 and STAT6, unlike PARP1 and PARP2. It catalyzes STAT1 mono-ADP ribosylation at “Glu-657” and “Glu-705”, reduces STAT1 phosphorylation and inhibits the production of pro-inflammatory cytokines in macrophages following IFNG stimulation. PARP14 Protein, Human (His, Strep) is the recombinant human-derived PARP14 protein, expressed by E. coli , with N-Strep, N-8*His labeled tag.
PARP14 Protein, an ADP-ribosyltransferase, facilitates the mono-ADP-ribosylation of glutamate residues on target proteins, distinguishing itself from PARP1 and PARP2 by its inability to mediate poly-ADP-ribosylation. Specifically, it has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', leading to decreased STAT1 phosphorylation and subsequent negative regulation of pro-inflammatory cytokine production in macrophages following IFNG stimulation. However, the exact role of ADP-ribosylation in preventing STAT1 phosphorylation has been debated, with suggestions that the inhibition may be a result of STAT1 'Lys-703' sumoylation. Additionally, PARP14 mono-ADP-ribosylates STAT6, enhancing STAT6-dependent transcription, and in macrophages, it positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation. Furthermore, PARP14 engages in mono-ADP-ribosylation of PARP9.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-StrepⅡ;N-8*His
-
Accession
Q460N5 (F1208-E1387)
-
Gene ID54625
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
PARP14 (F1208-E1387)
Accession # Q460N5 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PARP14; Protein Mono-ADP-Ribosyltransferase PARP14; Poly(ADP-Ribose) Polymerase Family Member 14; B Aggressive Lymphoma Protein 2; ARTD8; Poly [ADP-Ribose] Polymerase 14; BAL2; PARP-14; KIAA1268; B-Aggressive Lymphoma 2; PART8; Collaborator Of STAT6; ADP-
-
AA Sequence
FYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKRE
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
