RBP4 Protein, Human
Based on 1 Customer Validation
RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human is the recombinant human-derived RBP4 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human is the recombinant human-derived RBP4 protein, expressed by E. coli , with tag free.
The RBP4 protein serves as a retinol-binding protein, playing a crucial role in mediating the transport of retinol in blood plasma. It is implicated in delivering retinol from liver stores to peripheral tissues, and it likely transfers the bound all-trans retinol to STRA6, facilitating retinol transport across the cell membrane. RBP4 engages in interactions with TTR, a relationship that helps prevent its loss through filtration in the kidney glomeruli. Furthermore, the protein directly interacts with STRA6, reinforcing its involvement in the intricate processes of retinol transport and distribution in the body.
Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/mL can bind Human TTR (HY-P70500), the ED50 for this effect is < 1 µg/mL.
-
Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/mL can bind Human TTR (HY-P70500), the ED50 for this effect is 695.8 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P02753 (E19-L201)
-
Molecular Construction
-
N-term
-
RBP4 (E19-L201)
Accession # P02753 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Retinol-Binding Protein 4; Plasma Retinol-Binding Protein; PRBP; RBP; RBP4
-
AA Sequence
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
-
Predicted Molecular Mass
21 kDa
-
Molecular Weight
Approximately 20-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 10 mM CaCl2, 150 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 10 mM CaCl2, 150 mM NaCl, pH 7.5, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
