Serpin A1 Protein, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus^[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury^[2].

Alpha-1-antitrypsin 1-1 (Serpin A1a; AAT) is the most abundant circulating serine protease inhibitor (serpin) and the prototypic member of the serpin super family. The 52-kD Serpin A1a protein is coded by the gene SERPINA1. Serpin A1a plays an important role in modulating immunity, inflammation, proteostasis, apoptosis, and possibly cellular senescence programs. Systemic deficiency in Serpin A1a due to genetic mutations can result in liver failure and chronic lung disease such as emphysema^[1].

Human

HEK293

C-6*His

AAH11991.1 (E25-K418)

5265  [NCBI]

Partial

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK

50-65 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl₂, pH 7.5 or 20mM Tris-HCl, 50mM NaCl, 8% Trehalose, 4% Mannitol, 2mM CaCl₂,0.02% Tween 80, pH8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Hunt JM, et al. Alpha 1 anti-trypsin: one protein, many functions. Curr Mol Med. 2012 Aug;12(7):827-35.  [Content Brief]

  [2]. Yehudit Shabat, et al. Alpha-1 Anti-trypsin Exerts a Hepatoprotective Effect on Immune-mediated Hepatitis and Acetaminophen-induced Liver Injury. J Clin Transl Hepatol. 2018 Dec 28;6(4):345-349.  [Content Brief]