1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Serpins (Protease Inhibitors) Protease Inhibitors
  4. Serpin A1 Protein, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His)

Cat. No.: HY-P7542
Handling Instructions

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury[2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $550 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Serpin A1 Protein, Human (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

P01009 (E25-K418)

Gene ID

5265

Synonyms
rHuSerpin A1/alpha-1-Antitrypsin, His; Alpha-1-Antitrypsin; Alpha-1 Protease Inhibitor; Alpha-1-Antiproteinase; Serpin A1; SERPINA1; AAT; PI
AA Sequence

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHH

Molecular Weight

50-65 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl2, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Alpha-1-antitrypsin 1-1 (Serpin A1a; AAT) is the most abundant circulating serine protease inhibitor (serpin) and the prototypic member of the serpin super family. The 52-kD Serpin A1a protein is coded by the gene SERPINA1. Serpin A1a plays an important role in modulating immunity, inflammation, proteostasis, apoptosis, and possibly cellular senescence programs. Systemic deficiency in Serpin A1a due to genetic mutations can result in liver failure and chronic lung disease such as emphysema[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin A1 Protein, Human (HEK293, His)
Cat. No.:
HY-P7542
Quantity:
MCE Japan Authorized Agent: