1. Recombinant Proteins
  2. Others
  3. SHH Protein, Mouse (C25II)

SHH Protein, Mouse (C25II)

Cat. No.: HY-P7409
Handling Instructions

SHH Protein, Mouse (C25II) is a recombinant mouse sonic hedgehog variant.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $380 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE SHH Protein, Mouse (C25II)

SHH Protein, Mouse (C25II) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q62226 (G26-G198)

Gene ID

20423

Synonyms
rMuSonic Hedgehog, C25II; Hhg1
AA Sequence

IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Weight

Approximately 19.7 kDa

Biological Activity
The ED50 is <2 μg/mL as measured by C3H/10T1/2 (CCL-226) cells, corresponding to a specific activity of >500 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Sonic Hedgehog (SHH) is a secreted factor. The protein is heavily modified through cleavage and posttranslational modification and its release from producing cells can also be modulated by interactions with Dispatched, Scube2, and heparan sulfate proteoglycan. Sonic hedgehog (SHH) is the main ligand of hedgehog (Hh) pathway in mouse[1][2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SHH Protein, Mouse (C25II)
Cat. No.:
HY-P7409
Quantity:
MCE Japan Authorized Agent: