Copy Link Print Information

Siglec-15 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-15 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Siglec-15 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Siglec-15 Protein, Mouse (HEK293, His)
  • Siglec-15 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-15 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Siglec-15, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 acts upstream of or within regulation of actin cytoskeleton organization. Siglec-15 deficiency can promote bone formation and reduce bone resorption, indicating that Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis and may serve as a target to inhibit bone resorption and promote bone remodeling that increases bone mass. Siglec-15 is a predominantly macrophage-mediated suppressor of T cell responses. In tumors, Siglec-15 is negatively regulated by IFN-γ, thus influencing effector T cell-mediated antitumor immunity. Genetic ablation or antibody blockade of Siglec-15 amplifies anti-tumor immunity in the TME and inhibits tumor growth in some mouse models. Siglec-15 as a potential target for normalization cancer immunotherapy[1][2][3][4].

Verified Bioactivity

Immobilized Mouse Siglec-15-His at 2 μg/mL (100 μL/well) can bind Anti-Human Siglec15 mAb, the ED50 for this effect is 15-100 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Recombinant Mouse Siglec-15 at 2 μg/mL can bind Anti-Siglec-15 antibody. The ED50 for this effect is 15.18 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    A7E1W8 (R24-T262)

  • Gene ID
    620235  [NCBI]
  • Molecular Construction
    • N-term
    • Siglec-15 (R24-T262)
      Accession # A7E1W8
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SIGLEC15; Sialic Acid-Binding Ig-Like Lectin 15; Prev. CD33L3; SIGLEC-15; CD33 Antigen-Like 3; Sialic Acid Binding Ig-Like Lectin 15; HsT1361; Siglec-15; Sialic Acid Binding Ig Like Lectin 15; CD33 Molecule-Like 3

  • AA Sequence

    RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTST

  • Predicted Molecular Mass

    26.5 kDa

  • Molecular Weight

    Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 150 mM NaCl, 5% Thehalose, 0.3% Chaps, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Recombinant Mouse Siglec-15 at 2 μg/mL can bind Anti-Siglec-15 antibody. The ED50 for this effect is 15.18 ng/mL.

  • Siglec-15 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Siglec-15 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Siglec-15 Protein, Mouse (HEK293, His)
  • Siglec-15 Protein, Mouse (HEK293, His) Product Image