SIRT5 Protein, Human (Flag)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

SIRT5 Proteins, belonging to the sirtuin family, possess a sirtuin core domain and share homology with yeast Sir2 protein. They are classified in class III of the sirtuin family and undergo alternative splicing, resulting in multiple transcript variants. Their ubiquitous expression in tissues like the heart, liver, and 25 others suggests their involvement in diverse cellular processes. SIRT5 Protein, Human (Flag) is the recombinant human-derived SIRT5 protein, expressed by E. coli , with N-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SIRT5 Proteins, belonging to the sirtuin family, possess a sirtuin core domain and share homology with yeast Sir2 protein. They are classified in class III of the sirtuin family and undergo alternative splicing, resulting in multiple transcript variants. Their ubiquitous expression in tissues like the heart, liver, and 25 others suggests their involvement in diverse cellular processes. SIRT5 Protein, Human (Flag) is the recombinant human-derived SIRT5 protein, expressed by E. coli , with N-Flag labeled tag.

Background

SIRT5, a member of the sirtuin family, shares homology with the yeast Sir2 protein and is characterized by a sirtuin core domain. The sirtuin family is divided into four classes, and while the specific functions of human sirtuins are yet to be fully elucidated, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that human sirtuins may serve as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT5, classified within class III of the sirtuin family, undergoes alternative splicing, resulting in multiple transcript variants. The expression of SIRT5 is ubiquitous, observed in various tissues, including the heart, liver, and 25 other tissues, highlighting its likely involvement in diverse cellular processes.

Verified Bioactivity

Measured by its ability to remove the succinyl group from 25 μM fluorogenic peptide substrate incubate at room temperature for 30 minutes. The specific activity is 181.22 pmol/min/μg.

Assay Procedure

Materials
Assay buffer: 25 mM Tris, 150 mM NaCl, 1 mM DTT, pH 8.0
TCNB buffer:50 mM Tris, 0.15 M NaCl, 10 mM CaCl2, 0.05% Brij-35 (w/v), pH 7.5 (TCNB)
PRSS3/Trypsin-3 Protein, Human (HEK293, His) (HY-P75985)
Activator Protein: Enterokinase Protein, Bovine (His)
Stop Solution: 8 ng/μL Trypsin, 4 mM Nicotinamide, 50 mM Tris, 100 mM NaCl, 30% (v/v) Isopropanol, pH 8.0
Beta-NAD: Dilute in ultrapure water to 100 mM
Substrate: FLUOR DE LYS?-Succinyl, Desuccinylase Substrate (5 mM)
Standard: 7-Amino-4-methylcoumarin (HY-D0027)

Procedure
1. Prepare a standard curve using AMC standards with concentrations of 10000, 5000, 2500, 1250, 625, 312.5, 156.25, 78.125, 19.53, 9.76, 0 pmol. Read the fluorescence at excitation and emission wavelengths of 380 nm and 460 nm, respectively.
2. Activation of Human Trypsin-3:
a. Dilute Bovine Enterokinase to 2 μg/mL in TCNB buffer;
b. Dilute Human Trypsin-3 to 200 μg/mL in TCNB buffer;
c. Mix equal volumes of the diluted proteins;
d. Incubate overnight at room temperature.
3. Dilute the Human SIRT5 to 10 μg/mL in assay buffer.
4. Dilute the substrate to 100 μM in assay buffer containing 2 mM beta-NAD.
5. Add 25 μL of 10 μg/mL Human SIRT5 and 25 μL of diluted substrate to the wells. For the control group, add only 25 μL of 10 μg/mL Human SIRT5.
6. Seal the plate and incubate at 37°C for 30 minutes.
7. Add 50 μL of stop solution to all wells and mix. For the control wells, add the stop solution first and then add 25 μL of substrate.
8. Seal the plate and incubate at room temperature for 15 minutes.
9. Read the fluorescence in endpoint mode at excitation and emission wavelengths of 380 nm and 460 nm, respectively.
10. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Fluorescence* (RFU) x Conversion Factor ** (pmol/RFU)
Incubation time (min) x amount of enzyme (μg)

*Adjusted for Substrate Blank
**Derived using calibration standard

Per Well:
Human SIRT5: 0.025 μg
Substrate: 25 μM
beta-NAD: 0.5 mM

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-Flag
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Flag
    • SIRT5 (R2-S310)
      Accession # Q9NXA8-1/NP_036373.1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    SIRT5; Sirtuin (Silent Mating Type Information Regulation 2, S.Cerevisiae, Homolog) 5; Sirtuin 5; NAD-Dependent Lysine Demalonylase And Desuccinylase Sirtuin-5, Mitochondrial; NAD-Dependent Protein Deacylase Sirtuin-5, Mitochondrial; Silent Mating Type In

  • AA Sequence

    RPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

  • Predicted Molecular Mass

    34.7 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM DTT, pH 8.2.
2.Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.8 or PBS, pH 7.8, 1mM DTT, 5% trehalose, 5% mannitol and 0.01% Tween80.
3.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00