1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators Kinases
  3. Angiopoietins Endothelial cell CD Proteins Receptor Tyrosine Kinases Cytokine Receptors Transferases (EC 2) Protein Tyrosine Kinases TK
  4. TIE Receptors Tie
  5. TIE-2
  6. TIE-2 Protein, Mouse (Inactive, sf9, His-GST)

TIE-2 Protein, Mouse (Inactive, sf9, His-GST)

Cat. No.: HY-P73436
Handling Instructions Technical Support

TIE-2 is a tyrosine protein kinase that serves as a cell surface receptor for ANGPT1, ANGPT2, and ANGPT4 and is critical for angiogenesis, endothelial cell processes, and vascular stability.In addition to embryonic vasculogenesis, TIE-2 also affects postnatal hematopoiesis, regulating angiogenesis depending on the situation.TIE-2 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived TIE-2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

TIE-2 is a tyrosine protein kinase that serves as a cell surface receptor for ANGPT1, ANGPT2, and ANGPT4 and is critical for angiogenesis, endothelial cell processes, and vascular stability.In addition to embryonic vasculogenesis, TIE-2 also affects postnatal hematopoiesis, regulating angiogenesis depending on the situation.TIE-2 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived TIE-2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

TIE-2 protein, a tyrosine-protein kinase, acts as a cell-surface receptor for ANGPT1, ANGPT2, and ANGPT4, orchestrating a comprehensive range of processes critical for angiogenesis, endothelial cell survival, proliferation, migration, adhesion, and cell spreading, as well as the maintenance of vascular quiescence. Beyond its essential role in embryonic angiogenesis and heart development, TIE-2 plays a vital role in post-natal hematopoiesis. Its function post-birth involves context-dependent activation or inhibition of angiogenesis. In quiescent vessels, ANGPT1 oligomers recruit TIE-2 to cell-cell contacts, fostering complex formation with neighboring TIE-2 molecules and preferential activation of the phosphatidylinositol 3-kinase and AKT1 signaling cascades, leading to vascular stability. Conversely, in migrating endothelial cells lacking cell-cell adhesions, ANGPT1 recruits TIE-2 to contacts with the extracellular matrix, activating focal adhesion complexes, PTK2/FAK, and downstream kinases MAPK1/ERK2 and MAPK3/ERK1, stimulating sprouting angiogenesis. ANGPT1-triggered TIE-2 signaling involves receptor dimerization and autophosphorylation at specific tyrosine residues, serving as binding sites for scaffold proteins and effectors. Modulation by ANGPT2, which competes for the same binding site, and formation of heterodimers with TIE1, as well as proteolytic processing yielding a soluble extracellular domain, further regulate TIE-2 signaling. The soluble extracellular domain functions as a decoy receptor for angiopoietins, influencing signaling dynamics. TIE-2 phosphorylates DOK2, GRB7, GRB14, PIK3R1, SHC1, and TIE1, underscoring its intricate role in finely tuning a myriad of cellular responses.

Species

Mouse

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

Q02858 (Q770-A1122)

Gene ID
Molecular Construction
N-term
His-GST
TIE-2 (Q770-A1122)
Accession # Q02858
C-term
Protein Length

Cytoplasmic Domain

Synonyms
Angiopoietin-1 receptor; CD202b; hTIE2; p140 TEK; Tie2; VMCM
AA Sequence

QLKRANVQRRMAQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA

Predicted Molecular Mass
68.2 kDa
분자량

Approximately 68 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TIE-2 Protein, Mouse (Inactive, sf9, His-GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TIE-2 Protein, Mouse (Inactive, sf9, His-GST)
Cat. No.:
HY-P73436
수량:
MCE Japan Authorized Agent: