TIE-2 Protein, Mouse (Inactive, sf9, His-GST)

TIE-2 is a tyrosine protein kinase that serves as a cell surface receptor for ANGPT1, ANGPT2, and ANGPT4 and is critical for angiogenesis, endothelial cell processes, and vascular stability.In addition to embryonic vasculogenesis, TIE-2 also affects postnatal hematopoiesis, regulating angiogenesis depending on the situation.TIE-2 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived TIE-2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TIE-2 is a tyrosine protein kinase that serves as a cell surface receptor for ANGPT1, ANGPT2, and ANGPT4 and is critical for angiogenesis, endothelial cell processes, and vascular stability.In addition to embryonic vasculogenesis, TIE-2 also affects postnatal hematopoiesis, regulating angiogenesis depending on the situation.TIE-2 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived TIE-2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

TIE-2 protein, a tyrosine-protein kinase, acts as a cell-surface receptor for ANGPT1, ANGPT2, and ANGPT4, orchestrating a comprehensive range of processes critical for angiogenesis, endothelial cell survival, proliferation, migration, adhesion, and cell spreading, as well as the maintenance of vascular quiescence. Beyond its essential role in embryonic angiogenesis and heart development, TIE-2 plays a vital role in post-natal hematopoiesis. Its function post-birth involves context-dependent activation or inhibition of angiogenesis. In quiescent vessels, ANGPT1 oligomers recruit TIE-2 to cell-cell contacts, fostering complex formation with neighboring TIE-2 molecules and preferential activation of the phosphatidylinositol 3-kinase and AKT1 signaling cascades, leading to vascular stability. Conversely, in migrating endothelial cells lacking cell-cell adhesions, ANGPT1 recruits TIE-2 to contacts with the extracellular matrix, activating focal adhesion complexes, PTK2/FAK, and downstream kinases MAPK1/ERK2 and MAPK3/ERK1, stimulating sprouting angiogenesis. ANGPT1-triggered TIE-2 signaling involves receptor dimerization and autophosphorylation at specific tyrosine residues, serving as binding sites for scaffold proteins and effectors. Modulation by ANGPT2, which competes for the same binding site, and formation of heterodimers with TIE1, as well as proteolytic processing yielding a soluble extracellular domain, further regulate TIE-2 signaling. The soluble extracellular domain functions as a decoy receptor for angiopoietins, influencing signaling dynamics. TIE-2 phosphorylates DOK2, GRB7, GRB14, PIK3R1, SHC1, and TIE1, underscoring its intricate role in finely tuning a myriad of cellular responses.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • TIE-2 (Q770-A1122)
      Accession # Q02858
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    TEK; Tyrosine-Protein Kinase Receptor TEK; Prev. VMCM; Endothelial Tyrosine Kinase; VMCM1; Venous Malformations, Multiple Cutaneous And Mucosal; TIE2; Mutant TEK Tyrosine Kinase; Angiopoietin-1 Receptor; Soluble TIE2 Variant 2; CD202b; Soluble TIE2 Varian

  • AA Sequence

    QLKRANVQRRMAQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA

  • Predicted Molecular Mass

    68.2 kDa

  • Molecular Weight

    Approximately 68 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00