TLR7 Protein, Human (His, Myc)
The TLR7 protein is an endosomal receptor involved in innate and adaptive immunity. TLR7 Protein, Human (His, Myc) is the recombinant human-derived TLR7 protein, expressed by E. coli , with N-10*His and C-Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The TLR7 protein is an endosomal receptor involved in innate and adaptive immunity. TLR7 Protein, Human (His, Myc) is the recombinant human-derived TLR7 protein, expressed by E. coli , with N-10*His and C-Myc labeled tag.
TLR7 Protein serves as an endosomal receptor with a pivotal role in both innate and adaptive immunity. Its function involves orchestrating the host immune response against pathogens by recognizing uridine-containing single-strand RNAs (ssRNAs) of viral origin or guanosine analogs. Upon binding to agonists, TLR7 undergoes dimerization, facilitating the direct contact of Toll/Interleukin-1 receptor (TIR) domains and leading to the recruitment of the downstream adapter MYD88 through homotypic interaction. This initiates the formation of the Myddosome signaling complex involving IRAK4, IRAK1, TRAF6, and TRAF3, culminating in the activation of downstream transcription factors NF-kappa-B and IRF7. This cascade induces the production of pro-inflammatory cytokines and interferons, crucial for mounting an effective immune response. TLR7 exhibits activation not only by uridine-containing single-strand RNAs but also by guanosine analogs, such as deoxyguanosine, 7-thia-8-oxoguanosine, or 7-deazaguanosine, in a RNA-independent manner. Additionally, imiquimod is recognized as an activator of TLR7, further emphasizing its diverse and integral role in immune signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q9NYK1 (H861-V1049)
-
Molecular Construction
-
N-term
-
10*His
-
TLR7 (H861-V1049)
Accession # Q9NYK1 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TLR7; TLR7-Like; Toll Like Receptor 7; SLEB17; Toll-Like Receptor 7; IMD74; Toll-Like Receptor 7-Like
-
AA Sequence
HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV
-
Predicted Molecular Mass
29.5 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)