TLR7 Protein, Human (His, Myc)

The TLR7 protein is an endosomal receptor involved in innate and adaptive immunity. TLR7 Protein, Human (His, Myc) is the recombinant human-derived TLR7 protein, expressed by E. coli , with N-10*His and C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The TLR7 protein is an endosomal receptor involved in innate and adaptive immunity. TLR7 Protein, Human (His, Myc) is the recombinant human-derived TLR7 protein, expressed by E. coli , with N-10*His and C-Myc labeled tag.

Background

TLR7 Protein serves as an endosomal receptor with a pivotal role in both innate and adaptive immunity. Its function involves orchestrating the host immune response against pathogens by recognizing uridine-containing single-strand RNAs (ssRNAs) of viral origin or guanosine analogs. Upon binding to agonists, TLR7 undergoes dimerization, facilitating the direct contact of Toll/Interleukin-1 receptor (TIR) domains and leading to the recruitment of the downstream adapter MYD88 through homotypic interaction. This initiates the formation of the Myddosome signaling complex involving IRAK4, IRAK1, TRAF6, and TRAF3, culminating in the activation of downstream transcription factors NF-kappa-B and IRF7. This cascade induces the production of pro-inflammatory cytokines and interferons, crucial for mounting an effective immune response. TLR7 exhibits activation not only by uridine-containing single-strand RNAs but also by guanosine analogs, such as deoxyguanosine, 7-thia-8-oxoguanosine, or 7-deazaguanosine, in a RNA-independent manner. Additionally, imiquimod is recognized as an activator of TLR7, further emphasizing its diverse and integral role in immune signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • TLR7 (H861-V1049)
      Accession # Q9NYK1
    • Myc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TLR7; TLR7-Like; Toll Like Receptor 7; SLEB17; Toll-Like Receptor 7; IMD74; Toll-Like Receptor 7-Like

  • AA Sequence

    HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV

  • Predicted Molecular Mass

    29.5 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00