1. Recombinant Proteins
  2. Others
  3. TMEM175 Protein, Human (HEK293, His)

TMEM175 Protein, Human (HEK293, His) is the recombinant human-derived TMEM175, expressed by HEK293 , with His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMEM175 Protein, Human (HEK293, His) is the recombinant human-derived TMEM175, expressed by HEK293 , with His labeled tag. ,

Background

TMEM175 is a proton-activated proton channel that facilitates proton efflux from endosomes and lysosomes to maintain steady-state pH. It is activated at low pH (below 4.6) and selectively mediates lysosomal proton release, balancing V-ATPase activity for pH homeostasis (by similar: PubMed:35750034). Additionally, TMEM175 functions as a potassium channel at higher pH, regulating potassium conductance in endosomes and lysosomes. It serves as the pore-forming subunit of the lysoK(GF) complex, which consists of TMEM175 and AKT (AKT1, AKT2, or AKT3) and is activated by extracellular growth factors. The lysoK(GF) complex opens the TMEM175 channel via AKT-induced conformational changes, activating its function and playing a critical role in protecting neurons from stress-induced damage (by similar: PubMed:33505021).

Species

Human

Source

HEK293

Tag

His

Accession

Q9BSA9-1 (M1-C504)

Gene ID

84286

Protein Length

Full Length of Isoform-1

Synonyms
Endosomal/lysosomal proton channel TMEM175; Potassium channel TMEM175; Transmembrane protein 175; hTMEM175; TMEM175; Homo sapiens; Human; Ion channel; Potassium channel
AA Sequence

MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPC

Predicted Molecular Mass
86.4 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES pH 8.0, 150 mM KCl, 2 mM DTT, 0.01% (w/v) LMNG, 0.001 % (w/v) CHS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TMEM175 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TMEM175 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEM175 Protein, Human (HEK293, His)
Cat. No.:
HY-P703368
Quantity:
MCE Japan Authorized Agent: