TREM-2 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
TREM-2 Protein is a receptor for amyloid beta protein 42, lipoprotein particles, and apolipoprotein. TREM-2 Protein is involved in cell proliferation and apoptosis through Wnt/β, MTOR, PI3K and NF-kappa-B signaling pathways. TREM-2 Protein is expressed by macrophages, immature monocyte-derived dendritic cells, osteoclasts, and microglia to activate the immune response. TREM-2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TREM-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TREM-2 Protein is a receptor for amyloid beta protein 42, lipoprotein particles, and apolipoprotein. TREM-2 Protein is involved in cell proliferation and apoptosis through Wnt/β, MTOR, PI3K and NF-kappa-B signaling pathways. TREM-2 Protein is expressed by macrophages, immature monocyte-derived dendritic cells, osteoclasts, and microglia to activate the immune response. TREM-2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TREM-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
Triggering receptor expressed on myeloid cells 2 (TREM-2) can form a receptor signaling complex with TYROBP, mediating signaling and cell activation after ligand binding. TREM-2 is a receptor for amyloid beta protein 42 and mediates its uptake and degradation by microglia. Binding to amyloid-β42 mediates microglia activation, proliferation, migration, apoptosis and the expression of pro-inflammatory cytokines such as IL6R, CCL3 and anti-inflammatory cytokine ARG1. TREM-2 is a receptor for lipoprotein particles (such as LDL, VLDL, and HDL) and apolipoproteins (such as APOA1, APOA2, APOB, APOE, APOE2, APOE3, APOE4, and CLU) and enhances their uptake in microglia. TREM-2 acts as an upstream regulator of the Wnt/ beta-catenin signaling cascade to regulate microglial cell proliferation. TREM-2 acts on the metabolism of microglia by activating MTOR. TREM-2 inhibited the response of PI3K and NF-kappa-B signals to lipopolysaccharide. It can promote phagocytosis, inhibit the production of proinflammatory cytokines and nitric oxide, inhibit cell apoptosis, and increase the expression of IL10 and TGFB. During oxidative stress, it promotes anti-apoptotic NF-kappa-B signaling and ERK signaling. TREM-2 can trigger immune response activation of macrophages and dendritic cells mediating cytokine-induced fusion of macrophages to form multinucleated giant cells, and in dendritic cells mediating upregulation of chemokine receptor CCR7 and maturation and survival of dendritic cells[1][2][3][4][5][6].
Verified Bioactivity
1. Immobilized Biotinylated Human TREM2 His at 2 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-TREM2 Antibody hFc with the EC50 of 65.1 ng/mL determined by ELISA.
2. Immobilized Anti-TREM2 Antibody, hFc Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human TREM2, His Tag with the EC50 of 0.53 μg/mL determined by ELISA.
3. Immobilized Anti-TREM2 Antibody, hFc Tag at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human TREM2, His Tag with the EC50 of ≤0.2 μg/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q9NZC2-1 (H19-S174)
-
Molecular Construction
-
N-term
-
TREM-2 (H19-S174)
Accession # Q9NZC2-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
TREM2; Trem2b; Triggering Receptor Expressed On Myeloid Cells 2; Trem2c; TREM-2; Triggering Receptor Expressed On Myeloid Cells 2a; Triggering Receptor Expressed On Monocytes 2; PLOSL2; Trem2a; AD17
-
AA Sequence
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
-
Predicted Molecular Mass
20.3 kDa
-
Molecular Weight
Approximately 29-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (265 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Wunderlich P, et al. Sequential proteolytic processing of the triggering receptor expressed on myeloid cells-2 (TREM2) protein by ectodomain shedding and γ-secretase-dependent intramembranous cleavage. J Biol Chem. 2013 Nov 15;288(46):33027-36. [Content Brief]
[2]. Zhao Y, et al. TREM2 Is a Receptor for β-Amyloid that Mediates Microglial Function. Neuron. 2018 Mar 7;97(5):1023-1031.e7. [Content Brief]
[3]. Bouchon A, et al. Cutting edge: inflammatory responses can be triggered by TREM-1, a novel receptor expressed on neutrophils and monocytes. J Immunol. 2000 May 15;164(10):4991-5. [Content Brief]
[4]. Yeh FL, et al TREM2 Binds to Apolipoproteins, Including APOE and CLU/APOJ, and Thereby Facilitates Uptake of Amyloid-Beta by Microglia. Neuron. 2016 Jul 20;91(2):328-40. [Content Brief]
[5]. Kleinberger G, et al. TREM2 mutations implicated in neurodegeneration impair cell surface transport and phagocytosis. Sci Transl Med. 2014 Jul 2;6(243):243ra86. [Content Brief]
[6]. Bouchon A, et al. A DAP12-mediated pathway regulates expression of CC chemokine receptor 7 and maturation of human dendritic cells. J Exp Med. 2001 Oct 15;194(8):1111-22. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)