Search Result

Results for "

NMDARs

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Akt (2) Amino Acid Derivatives (5) Amyloid-β (3) Apoptosis (7) ATP Citrate Lyase (1) Autophagy (4) Bacterial (1) Calcium Channel (22) Calmodulin (1) CaMK (1) Cholinesterase (ChE) (4) DAPK (1) Dopamine Receptor (1) Dopamine Transporter (1) Drug Derivative (2) Drug Intermediate (1) Drug Metabolite (1) Endogenous Metabolite (26) ERK (7) Free Fatty Acid Receptor (1) GABA Receptor (4) Glutathione S-transferase (1) HDAC (1) HIV (2) iGluR (113) Imidazoline Receptor (2) Isotope-Labeled Compounds (14) Ligands for E3 Ligase (1) LXR (1) mGluR (3) Monoamine Transporter (1) mTOR (8) nAChR (2) NO Synthase (4) Opioid Receptor (1) P-glycoprotein (1) p38 MAPK (1) Phytohormone (1) PI3K (2) PKC (2) Potassium Channel (2) Reactive Oxygen Species (ROS) (1) Reference Standards (13) Serotonin Transporter (4) Tau Protein (3) TNF Receptor (2) Trk Receptor (2) TRP Channel (6)
By Research Areas:	Cancer (8) Cardiovascular Disease (3) Infection (3) Inflammation/Immunology (14) Metabolic Disease (28) Neurological Disease (99)

By Targets:

Akt (2)

Amino Acid Derivatives (5)

Amyloid-β (3)

Apoptosis (7)

ATP Citrate Lyase (1)

Autophagy (4)

Bacterial (1)

Calcium Channel (22)

Calmodulin (1)

CaMK (1)

Cholinesterase (ChE) (4)

DAPK (1)

Dopamine Receptor (1)

Dopamine Transporter (1)

Drug Derivative (2)

Drug Intermediate (1)

Drug Metabolite (1)

Endogenous Metabolite (26)

ERK (7)

Free Fatty Acid Receptor (1)

GABA Receptor (4)

Glutathione S-transferase (1)

HDAC (1)

HIV (2)

iGluR (113)

Imidazoline Receptor (2)

Isotope-Labeled Compounds (14)

Ligands for E3 Ligase (1)

LXR (1)

mGluR (3)

Monoamine Transporter (1)

mTOR (8)

nAChR (2)

NO Synthase (4)

Opioid Receptor (1)

P-glycoprotein (1)

p38 MAPK (1)

Phytohormone (1)

PI3K (2)

PKC (2)

Potassium Channel (2)

Reactive Oxygen Species (ROS) (1)

Reference Standards (13)

Serotonin Transporter (4)

Tau Protein (3)

TNF Receptor (2)

Trk Receptor (2)

TRP Channel (6)

By Research Areas:

Cancer (8)

Cardiovascular Disease (3)

Infection (3)

Inflammation/Immunology (14)

Metabolic Disease (28)

Neurological Disease (99)

126

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-N0215

L-Phenylalanine Maximum Cited Publications 8 Publications Verification (S)-2-Amino-3-phenylpropionic acid	Calcium Channel iGluR Endogenous Metabolite Ligands for E3 Ligase	Metabolic Disease Cancer
L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca ⁺ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (K_B of 573 μM ) and *non-NMDARs*, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-B0591

Memantine Maximum Cited Publications 10 Publications Verification	iGluR	Neurological Disease
Memantine is an orally active, noncompetitive N-methyl-D-aspartate receptor *(NMDAR)* antagonist. Memantine can be used for the research of moderate-to-severe Alzheimer's disease (AD) .

HY-16940

24(S)-Hydroxycholesterol 24S-OHC; 24S-HC; Cerebrosterol	LXR iGluR Endogenous Metabolite	Metabolic Disease
24(S)-Hydroxycholesterol (24S-OHC), the major brain cholesterol metabolite, plays an important role to maintain homeostasis of cholesterol in the brain. 24(S)-Hydroxycholesterol (24S-OHC) is one of the most efficient endogenous LXR agonist known and is present in the brain and in the circulation at relatively high levels. 24(S)-Hydroxycholesterol (24S-OHC) is a very potent, direct, and selective positive allosteric modulator of *NMDARs* with a mechanism that does not overlapthat of other allosteric modulators .

HY-100808

D-Serine 2 Publications Verification (R)-Serine	iGluR Endogenous Metabolite	Neurological Disease
D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-B1488

Tacrine hydrochloride 5+ Cited Publications	Cholinesterase (ChE) iGluR	Neurological Disease
Tacrine hydrochloride is a potent brain-penetrant inhibitor of both AChE and BChE, with IC₅₀s of 31 nM and 25.6 nM, respectively. Tacrine hydrochloride is also a *NMDAR* inhibitor, with an IC₅₀ of 26 μM. Tacrine hydrochloride can be used for the research of Alzheimer’s disease .

HY-Y0511

N,N-Dimethylglycine 1 Publications Verification Dimethylglycine; DMG; N-Methylsarcosine	Endogenous Metabolite iGluR Amino Acid Derivatives	Neurological Disease Metabolic Disease
N,N-Dimethylglycine (Dimethylglycine), a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine has antidepressant-like and surfactant effects .

HY-N0215S12

L-Phenylalanine-d5 1 Publications Verification (S)-2-Amino-3-phenylpropionic acid-d₅	Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine-d₅ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0837

Veratramine 1 Publications Verification NSC17821; NSC23880	PI3K Akt mTOR Autophagy Apoptosis	Neurological Disease Metabolic Disease Inflammation/Immunology Cancer
Veratramine (NSC17821; NSC23880) is an orally active inhibitor of the PI3K/Akt/mTOR signaling pathway and a SIGMAR1 modulator. Veratramine induces autophagic apoptosis of tumor cells, arrests the cell cycle at the G0/G1 phase, and inhibits epithelial-mesenchymal transition (EMT)-related proteins to reduce tumor migration. Veratramine reduces spinal cord and sciatic nerve pathological damage in a neuropathy model by inhibiting SIGMAR1 binding to *NMDAR* and phosphorylation of NMDAR Ser896. Veratramine has anti-tumor proliferation, apoptosis induction, anti-inflammatory and neuroprotective activities, and can be used in the study of cancers such as liver cancer and osteosarcoma, as well as diabetic peripheral neuropathy .

HY-17001

Flupirtine Maleate 1 Publications Verification D 9998 Maleate	Potassium Channel iGluR GABA Receptor	Neurological Disease Inflammation/Immunology
Flupirtine (D 9998) Maleate is an orally active, blood-brain barrier-crossing non-opioid analgesic and neuroprotective agent. Flupirtine Maleate is a neuronal potassium channel opener (Kv7 activator), a NMDA receptor antagonist and a GABA receptor activator. Flupirtine Maleate stabilizes blood-brain-barrier integrity, reduces oxidative stress and brain leukocyte infiltration, enhances angioneurogenesis, suppresses calcium influx, stabilizes neuronal resting membrane potential, and counteracts focal cerebral ischemia. Flupirtine Maleate exhibits analgesic, muscle relaxant properties, protects neurons from excitotoxic, ischemic, or cytokine-mediated death. Flupirtine Maleate functions as a non-opioid analgesic without antipyretic or antiphlogistic properties, shows no relevant affinity to opiate receptor. Flupirtine Maleate can be used for the research of focal cerebral ischemia, pain, Alzheimer’s disease, or multiple sclerosis .

HY-P5912

GluN1(356-385)	iGluR Calcium Channel	Neurological Disease
GluN1 (356-385) is a polypeptide targeting *NMDAR* GluN1. GluN1 (356-385) induces the production of autoantibodies, which reduce the density of cell surface *NMDAR* clusters, impair long-term potentiation, and decrease *NMDAR*-mediated Ca ²⁺ influx. As an immunogen, GluN1 (356-385) induces symptoms similar to anti-NMDAR encephalitis, including memory loss, in mice. GluN1 (356-385) can be used to establish a mouse model that mimics the pathogenesis of anti-NMDAR encephalitis. GluN1 (356-385) is applicable to research related to anti-NMDAR encephalitis .

HY-N0215S1

L-Phenylalanine-d8 1 Publications Verification (S)-2-Amino-3-phenylpropionic acid-d₈	Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine-d₈ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S8

L-Phenylalanine-13C6 1 Publications Verification (S)-2-Amino-3-phenylpropionic acid-¹³C₆	Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine- ¹³C₆ is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-B0340

Nefiracetam DM9384; DZL-221	nAChR iGluR mGluR PKC GABA Receptor Calcium Channel	Neurological Disease
Nefiracetam is a cognition-enhancing agent. Nefiracetam is an activator of nAChR, N-methyl-D-aspartate receptor (NMDAR), mGluR5, PKC, gamma-aminobutyric acid (GABA), and N/L-type Ca ²⁺ channels. Nefiracetam promotes neuroplasticity and enhances neuroprotection. Nefiracetam can be used in Alzheimer's disease, epilepsy, and cerebral ischemia research .

HY-13457

TCN 201 1 Publications Verification	iGluR	Neurological Disease
TCN 201 is a potent, selective and non-competitive antagonist of *GluN1/GluN2A NMDA* receptor, with a pIC₅₀** of 6.8. TCN 201 is selective for GluN1/GluN2A NMDA receptor over GluN1/GluN2B NMDA receptor (pIC₅₀<4.3) .

HY-107409

GNE 5729	iGluR	Neurological Disease
GNE 5729 is a brain permeable positive allosteric modulator of *NMDAR, with an EC₅₀* of 37 nM for GluN2A, 4.7 and 9.5 μM for GluN2C and GluN2D, respectively.

HY-P11117

TAT-EE3	TRP Channel iGluR Calcium Channel	Neurological Disease
TAT-EE3 is a neuroprotective peptide which can uncouple *TRPM2-NMDARs* interaction. TAT-EE3 inhibits TRPM2-induced enhancement of *NMDAR* surface expression and current amplitude.TAT-EE3 protects neurons against ischemic injury in vitro and in vivo. TAT-EE3can be used for the study of ischemic stroke .

HY-16728

Rapastinel 1 Publications Verification GLYX-13	iGluR ERK mTOR	Neurological Disease Cancer
Rapastinel (GLYX-13) is a potent *NMDAR* modulator capable of crossing the blood-brain barrier, and it exhibits extremely high affinity for human *NMDAR* (EC₅₀=0.0017-9.9 nM). Rapastinel enhances ERK signaling and activates the mTOR pathway, thereby upregulating the expression of BDNF and VGF, and inducing significant neuroplastic changes such as enhanced LTP and increased mature dendritic spine density in the hippocampus. Rapastinel moderately elevates the efflux of dopamine, norepinephrine and 5-HT in the prefrontal cortex, and uniquely avoids side effects of traditional antidepressants such as dissociation, addiction or sedation. Rapastinel is applicable to the research of major depressive disorder and hepatocellular carcinoma .

HY-N1916

Coniferyl ferulate 1 Publications Verification	Glutathione S-transferase P-glycoprotein Apoptosis iGluR CaMK p38 MAPK Reactive Oxygen Species (ROS) Bacterial	Infection Cardiovascular Disease Neurological Disease Inflammation/Immunology Cancer
Coniferyl ferulate is an orally active phenolic acid compound. Coniferyl ferulate is a potent inhibitor of glutathione S-transferase (GST) (IC₅₀ = 0.3 μM), which downregulates P-gp expression, induces apoptosis in B-MD-C1 (ADR+/+) cells, and reverses multidrug resistance. Coniferyl ferulate blocks the *NMDAR/NR2B-CaMKII-MAPKs* signaling pathway, inhibits ROS production and mitochondrial apoptosis, while reshapes the intestinal microbiota and microbial metabolism, ameliorates colonic inflammation and alleviates depressive symptoms in mice. Coniferyl ferulate can alleviate the toxicity of xylene to hematopoietic stem and progenitor cells by targeting Mgst2. Coniferyl ferulate exhibits antibacterial activity against the Gram-positive Bacillus subtilis and Staphylococcus aureus .

HY-101955A

(2R,6R)-Hydroxynorketamine hydrochloride (2R,6R)-HNK hydrochloride	Drug Metabolite	Neurological Disease
(2R,6R)-Hydroxynorketamine ((2R,6R)-HNK) hydrochloride is an active ketamine metabolite with no *NMDAR* binding activity. (2R,6R)-Hydroxynorketamine hydrochloride rescues impaired dorsal hippocampal long-term potentiation and restores robust long-term potentiation in the hippocampal SC-CA1 pathway. (2R,6R)-Hydroxynorketamine hydrochloride can be used for research on depression .

HY-111973

Phaseic acid	Phytohormone iGluR	Neurological Disease
Phaseic acid is a Abscisic acid terpenoid catabolite that can able to activate a subset of Abscisic acid repectors. Phaseic acid is a plant hormone associated with photosynthesis arrest and abscission. Phaseic acid is the antagonist for NMDA-type glutamate receptor (NMDAR) that inhibits NMDAR currents with an IC₅₀ of 34.37 μM. Phaseic acid reduces intracellular calcium influx, and exhibits neuroprotective effect .

HY-100457

IC87201 2 Publications Verification	iGluR	Neurological Disease
IC87201, an inhibitor of PSD95-nNOS protein-protein interactions, suppresses *NMDAR*-dependent NO and cGMP formation.

HY-N0215S10

L-Phenylalanine-13C9 1 Publications Verification (S)-2-Amino-3-phenylpropionic acid-¹³C₉	Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine- ¹³C₉ is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-41239

1-Bromo-3,5-dimethyladamantane	Drug Intermediate	Others
1-Bromo-3,5-dimethyladamantane is an intermediate for Memantine (HY-B0591). Memantine is an orally active, noncompetitive N-methyl-D-aspartate receptor (NMDAR) antagonist. Memantine can be used for the research of moderate-to-severe Alzheimer's disease (AD).

HY-139192

Brophenexin 3 Publications Verification NMDAR/TRPM4-IN-2	iGluR TRP Channel ERK	Neurological Disease
Brophenexin (compound 8) is a potent *NMDAR/TRPM4* interaction interface inhibitor. Brophenexin shows neuroprotective activity. Brophenexin prevents NMDA-induced cell death and mitochondrial dysfunction in hippocampal neurons, with an IC₅₀ of 2.1 μM. Brophenexin protects mice from MCAO-induced brain damage and NMDA-induced retinal ganglion cell loss .

HY-W001158

N,N-Dimethylglycine hydrochloride 1 Publications Verification Dimethylglycine hydrochloride; DMG hydrochloride; N-Methylsarcosine hydrochloride	Endogenous Metabolite iGluR Amino Acid Derivatives	Neurological Disease Metabolic Disease
N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

HY-P5911

GluN1(359-378)	iGluR	Inflammation/Immunology
GluN1 (359-378) is an anti-N-methyl-D-aspartate receptor (NMDAR) peptide. GluN1 (359-378) can cross the blood-brain barrier. GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting the immune system .

HY-108337

GNE-0723	iGluR	Neurological Disease
GNE-0723 is a brain permeable positive allosteric modulator of *NMDAR, with an EC₅₀* of 21 nM for GluN2A, 7.4 and 6.2 μM for GluN2C and GluN2D, respectively .

HY-N0215R

L-Phenylalanine (Standard) (S)-2-Amino-3-phenylpropionic acid (Standard)	Reference Standards Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine (Standard) is the analytical standard of L-Phenylalanine. This product is intended for research and analytical applications. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S5

L-Phenylalanine-15N (S)-2-Amino-3-phenylpropionic acid-¹⁵N	Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine- ¹⁵N is the ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S11

L-Phenylalanine-13C9,15N (S)-2-Amino-3-phenylpropionic acid-¹³C₉,¹⁵N	Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine- ¹³C₉, ¹⁵N is the ¹³C- and ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-16728B

Rapastinel Trifluoroacetate 1 Publications Verification GLYX-13 Trifluoroacetate	iGluR mTOR ERK	Neurological Disease
Rapastinel (GLYX-13) Trifluoroacetate is a potent *NMDAR* modulator capable of crossing the blood-brain barrier, and it exhibits extremely high affinity for human *NMDAR* (EC₅₀=0.0017-9.9 nM). Rapastinel Trifluoroacetate enhances ERK signaling and activates the mTOR pathway, thereby upregulating the expression of BDNF and VGF, and inducing significant neuroplastic changes such as enhanced LTP and increased mature dendritic spine density in the hippocampus. Rapastinel Trifluoroacetate moderately elevates the efflux of dopamine, norepinephrine and 5-HT in the prefrontal cortex, and uniquely avoids side effects of traditional antidepressants such as dissociation, addiction or sedation. Rapastinel Trifluoroacetate is applicable to the research of major depressive disorder and hepatocellular carcinoma .

HY-P991611

ART5803	iGluR	Inflammation/Immunology
ART5803 is a humanized IgG1 monoclonal antibody inhibitor targeting *NMDAR. ART5803 binds to the N-terminal domain (NTD) of the NMDAR* GluN1 subunit (GluN1-NTD) with a high affinity. ART5803 blocks NMDAR internalization induced by pathogenic autoantibodies and restores cell-surface NMDAR expression and functions. ART5803 reverses behavioral abnormalities and NMDAR expression in marmoset disease models. ABT-147 can be used to study anti-NMDAR encephalitis .

HY-107498

GNE-8324	iGluR	Neurological Disease
GNE-8324 is a selective GluN2A positive allosteric modulator. GNE-8324 selectively enhances **NMDA receptor (NMDAR)**-mediated synaptic responses in inhibitory but not excitatory neurons .

HY-129527

GNE-9278	iGluR	Neurological Disease
GNE-9278 is a highly selective positive allosteric modulator of *NMDAR* that acts at the GluN1 transmembrane domain (TMD). GNE-9278 acts on activated *NMDARs* to increase peak current and agonist affinity .

HY-W008038

NMDAR antagonist 3	iGluR	Others
NMDAR antagonist 3 (Compound 2) is an antagonist of the *NMDA* receptor. NMDAR antagonist 3 has a certain but weak inhibitory activity against the NR1A/2B subtype of the *NMDA* receptor .

HY-172261

YY-23	iGluR	Neurological Disease
YY-23 is a selective inhibitor of *NMDAR* (containing GluN2C or GluN2D). YY-23 inhibits GABAergic neurotransmission and enhances excitatory transmission by inhibiting *NMDARs* containing GluN2D on GABAergic interneurons in the prefrontal cortex. YY-23 has antidepressant activity and can be used for the research of neurological diseases .

HY-100808S

D-Serine-d3 (R)-Serine-d₃	Isotope-Labeled Compounds Endogenous Metabolite iGluR	Neurological Disease
D-Serine-d₃ ((R)-Serine-d₃) is a deuterium labeled D-Serine (HY-100808). D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-N0215S3

L-Phenylalanine-d2 (S)-2-Amino-3-phenylpropionic acid-d₂	Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine-d₂ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S7

L-Phenylalanine-3-13C 1 Publications Verification (S)-2-Amino-3-phenylpropionic acid-3-¹³C	Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine-3- ¹³C is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-155811

DQP-997-74	iGluR	Neurological Disease
DQP-997-74 (compound 2i) is a selective negative allosteric modulator of N-methyl-d-aspartate receptor (NMDAR), specifically targeting GluN2C/D (IC₅₀: 0.069 μM and 0.035 μM), with blood-brain barrier penetrability. Where DQP refers to dihydroquinoline-pyrazoline. DQP-997-74 acts synergistically with the agonist glutamate to exhibit time-dependent enhanced potency in inhibiting hypersynchronous activity driven by high-frequency excitatory synaptic transmission. DQP-997-74 reduces the number of epileptogenesis in a murine model of tuberous sclerosis complex (TSC)-induced epilepsy. DQP-997-74 can be used for research on NMDAR-related neurological diseases .

HY-149967

*GluN2B-NMDAR* antagonist-1**	iGluR	Neurological Disease Inflammation/Immunology
GluN2B-NMDAR antagonist-1 is an orally active *GluN2B-NMDAR* antagonist. GluN2B-NMDAR antagonist-1 has neuroprotective activity. GluN2B-NMDAR antagonist-1 can be used for research of ischemic injury .

HY-107423

GNE 6901	iGluR	Neurological Disease
GNE 6901 (compound 40) is a potent GluN2A-selective NMDAR positive allosteric modulator (PAM) with an EC₅₀ of 382 nM .

HY-N0215S2

L-Phenylalanine-13C 1 Publications Verification (S)-2-Amino-3-phenylpropionic acid-¹³C	Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine- ¹³C is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-100547

IEM-1754	iGluR	Neurological Disease
IEM-1754, a dicationic adamantane derivative, is a potent blocker of open channels of native ionotropic glutamate receptors including quisqualate-sensitive receptors in insect muscles, *NMDAR* in cultured rat cortical neurons, and AMPAR in freshly isolated hippocampal cells. IEM-1754 shows anticonvulsant potency in vivo .

HY-111500A

NMDAR antagonist 1	iGluR	Neurological Disease
NMDAR antagonist 1 is a potent and orally bioavailable NR2B-selective *NMDAR* antagonist .

HY-N11978

6-Hydroxykynurenic acid 6-HKA	iGluR	Neurological Disease
6-Hydroxykynurenic acid (6-HKA) is a derivative of kynurenic acid (KYNA) and can be isolated from Ginkgo leaves. 6-Hydroxykynurenic acid is a low-affinity NMDAR antagonist (IC₅₀: 59 μM) .

HY-N0215S14

L-Phenylalanine-15N,d8 (S)-2-Amino-3-phenylpropionic acid-¹⁵N,d₈	Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite	Metabolic Disease
L-Phenylalanine- ¹⁵N,d₈ is the deuterium and ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca2+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N11061

Withaphysalin D	iGluR	Neurological Disease
Withaphysalin D is a selective antagonist against the N-methyl-D-aspartate receptor (NMDAR) containing GluN2B. Withaphysalin D can be isolated from water lilies and has neuroprotective properties. Withaphysalin D is able to cross the blood-brain barrier .

HY-P10357

TAT-CBD3	HIV iGluR	Infection Inflammation/Immunology
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .

HY-111500

*(Rac)-NMDAR* antagonist 1**	iGluR	Neurological Disease
(Rac)-NMDAR antagonist 1 is the racemate of NMDAR antagonist 1. NMDAR antagonist 1 is a potent and orally bioavailable NR2B-selective *NMDAR* antagonist .

Cat. No.	Product Name	Target	Research Area

HY-P5912

GluN1(356-385)	iGluR Calcium Channel	Neurological Disease
GluN1 (356-385) is a polypeptide targeting *NMDAR* GluN1. GluN1 (356-385) induces the production of autoantibodies, which reduce the density of cell surface *NMDAR* clusters, impair long-term potentiation, and decrease *NMDAR*-mediated Ca ²⁺ influx. As an immunogen, GluN1 (356-385) induces symptoms similar to anti-NMDAR encephalitis, including memory loss, in mice. GluN1 (356-385) can be used to establish a mouse model that mimics the pathogenesis of anti-NMDAR encephalitis. GluN1 (356-385) is applicable to research related to anti-NMDAR encephalitis .

HY-P0117

Tat-NR2B9c Maximum Cited Publications 8 Publications Verification Tat-NR2Bct; NA-1	iGluR NO Synthase	Neurological Disease
Tat-NR2B9c (Tat-NR2Bct; NA-1) is a postsynaptic density-95 (PSD-95) inhibitor, with EC₅₀ values of 6.7 nM and 670 nM for PSD-95d2 (PSD-95 PDZ domain 2) and PSD-95d1, respectively. Tat-NR2B9c disrupts the PSD-95/NMDAR interaction, inhibiting NR2A and NR2B binding to PSD-95 with IC₅₀ values of 0.5 μM and 8 μM, respectively. Tat-NR2B9c also inhibits neuronal nitric oxide synthase (nNOS)/PSD-95 interaction, and possesses neuroprotective efficacy .

HY-P11117

TAT-EE3	TRP Channel iGluR Calcium Channel	Neurological Disease
TAT-EE3 is a neuroprotective peptide which can uncouple *TRPM2-NMDARs* interaction. TAT-EE3 inhibits TRPM2-induced enhancement of *NMDAR* surface expression and current amplitude.TAT-EE3 protects neurons against ischemic injury in vitro and in vivo. TAT-EE3can be used for the study of ischemic stroke .

HY-W001158

N,N-Dimethylglycine hydrochloride 1 Publications Verification Dimethylglycine hydrochloride; DMG hydrochloride; N-Methylsarcosine hydrochloride	Endogenous Metabolite iGluR Amino Acid Derivatives	Neurological Disease Metabolic Disease
N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

HY-P5911

GluN1(359-378)	iGluR	Inflammation/Immunology
GluN1 (359-378) is an anti-N-methyl-D-aspartate receptor (NMDAR) peptide. GluN1 (359-378) can cross the blood-brain barrier. GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting the immune system .

HY-P0117A

Tat-NR2B9c TFA Maximum Cited Publications 8 Publications Verification Tat-NR2Bct TFA; NA-1 TFA	iGluR NO Synthase	Neurological Disease
Tat-NR2B9c TFA (Tat-NR2Bct TFA) is a postsynaptic density-95 (PSD-95) inhibitor, with EC₅₀ values of 6.7 nM and 670 nM for PSD-95d2 (PSD-95 PDZ domain 2) and PSD-95d1, respectively. Tat-NR2B9c TFA disrupts the PSD-95/NMDAR interaction, inhibiting NR2A and NR2B binding to PSD-95 with IC₅₀ values of 0.5 μM and 8 μM, respectively. Tat-NR2B9c TFA also inhibits neuronal nitric oxide synthase (nNOS)/PSD-95 interaction, and possesses neuroprotective efficacy .

HY-P10357

TAT-CBD3	HIV iGluR	Infection Inflammation/Immunology
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P2471

Neurogranin (48-76), mouse	Calmodulin	Neurological Disease
Neurogranin (48-76), mouse is a peptide corresponding to residues 48-76 of Neurogranin. Neurogranin, a calmodulin-binding protein, is exclusively expressed in the post-synapse, and mediates NMDAR driven synaptic plasticity by regulating the calcium-calmodulin (Ca ²⁺-CaM) pathway .

HY-P2307

Tat-NR2Baa	iGluR NO Synthase	Neurological Disease
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .

HY-P2307A

Tat-NR2Baa TFA	iGluR NO Synthase	Neurological Disease
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .

HY-P7060

NT 13 TPPT	iGluR	Neurological Disease
NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. NT 13 is a partial N-methyl-D-aspartate receptor (NMDAR) agonist used in the study of depression, anxiety, and other related diseases.

HY-P5277

TAT-GluN2BCTM	DAPK	Neurological Disease
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P10357A

Tat-CBD3 TFA	HIV iGluR	Infection Inflammation/Immunology
Tat-CBD3 TFA, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .

Cat. No.	Product Name	Target	Research Area	Image

HY-P991611

ART5803	iGluR	Inflammation/Immunology
ART5803 is a humanized IgG1 monoclonal antibody inhibitor targeting *NMDAR. ART5803 binds to the N-terminal domain (NTD) of the NMDAR* GluN1 subunit (GluN1-NTD) with a high affinity. ART5803 blocks NMDAR internalization induced by pathogenic autoantibodies and restores cell-surface NMDAR expression and functions. ART5803 reverses behavioral abnormalities and NMDAR expression in marmoset disease models. ABT-147 can be used to study anti-NMDAR encephalitis .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-N0215

L-Phenylalanine Maximum Cited Publications 8 Publications Verification (S)-2-Amino-3-phenylpropionic acid	Structural Classification Microorganisms Animals Classification of Application Fields Metabolic Disease Amino acids Endogenous metabolite Disease Research Fields Source Classification	Calcium Channel iGluR Endogenous Metabolite Ligands for E3 Ligase
L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca ⁺ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (K_B of 573 μM ) and *non-NMDARs*, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-16940

24(S)-Hydroxycholesterol 24S-OHC; 24S-HC; Cerebrosterol	Classification of Application Fields Disease markers Metabolic Disease Nervous System Disorder Endogenous metabolite Disease Research Fields Steroids Source Classification	LXR iGluR Endogenous Metabolite
24(S)-Hydroxycholesterol (24S-OHC), the major brain cholesterol metabolite, plays an important role to maintain homeostasis of cholesterol in the brain. 24(S)-Hydroxycholesterol (24S-OHC) is one of the most efficient endogenous LXR agonist known and is present in the brain and in the circulation at relatively high levels. 24(S)-Hydroxycholesterol (24S-OHC) is a very potent, direct, and selective positive allosteric modulator of *NMDARs* with a mechanism that does not overlapthat of other allosteric modulators .

HY-100808

D-Serine 2 Publications Verification (R)-Serine	Human Gut Microbiota Metabolites Microorganisms Amino acids Endogenous metabolite Source Classification	iGluR Endogenous Metabolite
D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-Y0511

N,N-Dimethylglycine 1 Publications Verification Dimethylglycine; DMG; N-Methylsarcosine	Microorganisms Other disease Classification of Application Fields Disease markers Other Diseases Amino acids Endogenous metabolite Disease Research Fields Source Classification	Endogenous Metabolite iGluR Amino Acid Derivatives
N,N-Dimethylglycine (Dimethylglycine), a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine has antidepressant-like and surfactant effects .

HY-N10546

Ganglioside GM1	Structural Classification Natural Products Animals	iGluR Trk Receptor ERK Apoptosis Autophagy
Ganglioside GM1 is a type of glycosphingolipid, mainly found on the cell membranes of the central nervous system of vertebrates. Ganglioside GM1 exerts neuroprotective effects by reducing excessive activation of *NMDAR, activating TrkA* and ERK1/2, and inhibiting oxidative stress and cell apoptosis and autophagy. Ganglioside GM1 can be used in the research of diseases such as traumatic brain injury, Parkinson's disease, Alzheimer's disease, and Huntington's disease .

HY-N0837

Veratramine 1 Publications Verification NSC17821; NSC23880	Alkaloids Piperidine Alkaloids Structural Classification other families Classification of Application Fields Plants Disease Research Fields Source Classification Cancer	PI3K Akt mTOR Autophagy Apoptosis
Veratramine (NSC17821; NSC23880) is an orally active inhibitor of the PI3K/Akt/mTOR signaling pathway and a SIGMAR1 modulator. Veratramine induces autophagic apoptosis of tumor cells, arrests the cell cycle at the G0/G1 phase, and inhibits epithelial-mesenchymal transition (EMT)-related proteins to reduce tumor migration. Veratramine reduces spinal cord and sciatic nerve pathological damage in a neuropathy model by inhibiting SIGMAR1 binding to *NMDAR* and phosphorylation of NMDAR Ser896. Veratramine has anti-tumor proliferation, apoptosis induction, anti-inflammatory and neuroprotective activities, and can be used in the study of cancers such as liver cancer and osteosarcoma, as well as diabetic peripheral neuropathy .

HY-N1916

Coniferyl ferulate 1 Publications Verification	Classification of Application Fields Simple Phenylpropanols Phenols Polyphenols Dicerothamnus rhinocerotis Phenylpropanoids Umbelliferae Plants Disease Research Fields Source Classification Cancer	Glutathione S-transferase P-glycoprotein Apoptosis iGluR CaMK p38 MAPK Reactive Oxygen Species (ROS) Bacterial
Coniferyl ferulate is an orally active phenolic acid compound. Coniferyl ferulate is a potent inhibitor of glutathione S-transferase (GST) (IC₅₀ = 0.3 μM), which downregulates P-gp expression, induces apoptosis in B-MD-C1 (ADR+/+) cells, and reverses multidrug resistance. Coniferyl ferulate blocks the *NMDAR/NR2B-CaMKII-MAPKs* signaling pathway, inhibits ROS production and mitochondrial apoptosis, while reshapes the intestinal microbiota and microbial metabolism, ameliorates colonic inflammation and alleviates depressive symptoms in mice. Coniferyl ferulate can alleviate the toxicity of xylene to hematopoietic stem and progenitor cells by targeting Mgst2. Coniferyl ferulate exhibits antibacterial activity against the Gram-positive Bacillus subtilis and Staphylococcus aureus .

HY-N0215R

L-Phenylalanine (Standard) (S)-2-Amino-3-phenylpropionic acid (Standard)	Structural Classification Microorganisms Animals Amino acids Endogenous metabolite Source Classification	Reference Standards Calcium Channel iGluR Endogenous Metabolite
L-Phenylalanine (Standard) is the analytical standard of L-Phenylalanine. This product is intended for research and analytical applications. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0837R

Veratramine (Standard) NSC17821 (Standard); NSC23880 (Standard)	Alkaloids Piperidine Alkaloids Structural Classification other families Plants Source Classification	Reference Standards PI3K Akt mTOR Autophagy Apoptosis
Veratramine (NSC17821; NSC23880) (Standard) is the analytical standard of Veratramine (HY-N0837). This product is intended for research and analytical applications. Veratramine (NSC17821; NSC23880) is an orally active inhibitor of the PI3K/Akt/mTOR signaling pathway and a SIGMAR1 modulator. Veratramine induces autophagic apoptosis of tumor cells, arrests the cell cycle at the G0/G1 phase, and inhibits epithelial-mesenchymal transition (EMT)-related proteins to reduce tumor migration. Veratramine reduces spinal cord and sciatic nerve pathological damage in a neuropathy model by inhibiting SIGMAR1 binding to *NMDAR* and phosphorylation of NMDAR Ser896. Veratramine has anti-tumor proliferation, apoptosis induction, anti-inflammatory and neuroprotective activities, and can be used in the study of cancers such as liver cancer and osteosarcoma, as well as diabetic peripheral neuropathy .

HY-Y0511R

N,N-Dimethylglycine (Standard) 1 Publications Verification Dimethylglycine (Standard); DMG (Standard); N-Methylsarcosine (Standard)	Structural Classification Microorganisms Other disease Disease markers Amino acids Endogenous metabolite Source Classification	Reference Standards Endogenous Metabolite iGluR Amino Acid Derivatives
N,N-Dimethylglycine (Dimethylglycine) (Standard) is the analytical standard of N,N-Dimethylglycine (HY-Y0511). This product is intended for research and analytical applications. N,N-Dimethylglycine (Dimethylglycine), a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine has antidepressant-like and surfactant effects.

HY-N11978

6-Hydroxykynurenic acid 6-HKA	Ginkgoaceae Ketones, Aldehydes, Acids Plants Ginkgo biloba Source Classification	iGluR
6-Hydroxykynurenic acid (6-HKA) is a derivative of kynurenic acid (KYNA) and can be isolated from Ginkgo leaves. 6-Hydroxykynurenic acid is a low-affinity NMDAR antagonist (IC₅₀: 59 μM) .

HY-N11061

Withaphysalin D	Physalis minima Linn. Plants Solanaceae Steroids Source Classification	iGluR
Withaphysalin D is a selective antagonist against the N-methyl-D-aspartate receptor (NMDAR) containing GluN2B. Withaphysalin D can be isolated from water lilies and has neuroprotective properties. Withaphysalin D is able to cross the blood-brain barrier .

HY-100808R

D-Serine (Standard) (R)-Serine (Standard)	Structural Classification Human Gut Microbiota Metabolites Microorganisms Amino acids Endogenous metabolite Source Classification	Reference Standards iGluR Endogenous Metabolite
D-Serine (Standard) is the analytical standard of D-Serine. This product is intended for research and analytical applications. D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration[1][2].

Cat. No.	Product Name	Chemical Structure

HY-N0215S12

L-Phenylalanine-d5

1 Publications Verification

L-Phenylalanine-d₅ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S1

L-Phenylalanine-d8

1 Publications Verification

L-Phenylalanine-d₈ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S8

L-Phenylalanine-13C6

1 Publications Verification

L-Phenylalanine- ¹³C₆ is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-W001158S

N,N-Dimethylglycine-d6 hydrochloride

N,N-Dimethylglycine-d₆ (Dimethylglycine-d₆) hydrochloride is the deuterium labeled N,N-Dimethylglycine hydrochloride (HY-W001158). N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

HY-N0215S10

L-Phenylalanine-13C9

1 Publications Verification

L-Phenylalanine- ¹³C₉ is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S5

L-Phenylalanine-15N

L-Phenylalanine- ¹⁵N is the ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S11

L-Phenylalanine-13C9,15N

L-Phenylalanine- ¹³C₉, ¹⁵N is the ¹³C- and ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-100808S

D-Serine-d3

D-Serine-d₃ ((R)-Serine-d₃) is a deuterium labeled D-Serine (HY-100808). D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-N0215S3

L-Phenylalanine-d2

L-Phenylalanine-d₂ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S7

L-Phenylalanine-3-13C

1 Publications Verification

L-Phenylalanine-3- ¹³C is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S2

L-Phenylalanine-13C

1 Publications Verification

L-Phenylalanine- ¹³C is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S14

L-Phenylalanine-15N,d8

L-Phenylalanine- ¹⁵N,d₈ is the deuterium and ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca2+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S6

DL-Phenylalanine-d5 hydrochloride

DL-Phenylalanine-d₅ (hydrochloride) is the deuterium labeled DL-Phenylalanine hydrochloride. L-Phenylalanine hydrochloride is an essential amino acid isolated from Escherichia coli. L-Phenylalanine hydrochloride is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine hydrochloride is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine hydrochloride is widely used in the production of food flavors and pharmaceuticals .

HY-178251S

L-Phenylalanine-d

L-Phenylalanine-d is the deuterium labeled L-Phenylalanine (HY-N0215). L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca ²⁺ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S

L-Phenylalanine-d7

L-Phenylalanine-d₇ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S13

L-Phenylalanine-d1

L-Phenylalanine-d is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-B0591S

Memantine-d3 hydrochloride
Memantine-d₃ (hydrochloride) is deuterium labeled Memantine. Memantine is an orally active, noncompetitive N-methyl-D-aspartate receptor (NMDAR) antagonist. Memantine can be used for the research of moderate-to-severe Alzheimer's disease (AD) .

HY-N0215S9

L-Phenylalanine-13C9,15N,d8

L-Phenylalanine- ¹³C₉, ¹⁵N,d₈ is the deuterium, ¹³C-, and 15-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-W001158S1

N,N-Dimethylglycine-d3 hydrochloride

N,N-Dimethylglycine-d₃ (Dimethylglycine-d₃) hydrochloride is the deuterium labeled N,N-Dimethylglycine hydrochloride (HY-W001158). N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

NMDARs

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

NaturalProducts

Isotope-Labeled Compounds

Natural
Products