2. Search Result
Search Result
Results for "

adjuvant-induced arthritis

" in MedChemExpress (MCE) Product Catalog:

33

Inhibitors & Agonists

5

Peptides

2

Natural
Products

1

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-10999
    Trametinib
    Maximum Cited Publications
    286 Publications Verification

    GSK1120212; JTP-74057

    		 MEK Autophagy Apoptosis Infection Neurological Disease Metabolic Disease Inflammation/Immunology Cancer
    Trametinib (GSK1120212; JTP-74057) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib activates autophagy and induces apoptosis, cross the blood-brain barrier (BBB), used in research related to subarachnoid hemorrhage (SAH) .
    Trametinib
  • HY-100754
    Ritlecitinib
    5+ Cited Publications

    PF-06651600

    		 JAK Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (PF-06651600) is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib
  • HY-10999A
    Trametinib (DMSO solvate)
    Maximum Cited Publications
    286 Publications Verification

    GSK-1120212 (DMSO solvate); JTP-74057 (DMSO solvate)

    		 MEK Apoptosis Cancer
    Trametinib (DMSO solvate) (GSK-1120212 (DMSO solvate)) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib (DMSO solvate) activates autophagy and induces apoptosis . This product is in solid form, a DMSO solvate, and a stable crystalline form.
    Trametinib (DMSO solvate)
  • HY-N0807
    Swertiamarin
    1 Publications Verification

    		 MMP NF-κB JAK Keap1-Nrf2 Metabolic Disease Inflammation/Immunology Cancer
    Swertiamarin is an orally active natural product with hypoglycemic, lipid-lowering, anti-rheumatic, and antioxidant activities. Swertiamarin can regulate the levels of pro-inflammatory cytokines, MMP, and NF-κB, and promote osteoblast proliferation. Swertiamarin has antioxidant and hepatoprotective effects against carbon tetrachloride induced rat liver toxicity through the Nrf2/HO-1 pathway. Swertiamarin can attenuate inflammatory mediators by regulating JAK2/STAT3 transcription factors in adjuvant induced arthritis rats. Swertiamarin can be used in the research of diabetes and arthritis .
    Swertiamarin
  • HY-100754C
    Ritlecitinib tosylate
    5+ Cited Publications

    PF-06651600 tosylate

    		 JAK Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (PF-06651600) tosylate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib tosylate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib tosylate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib tosylate
  • HY-101432
    Fenclozic acid

    ICI-54450; Acidum fenclozicum; Mialex

    		 COX Inflammation/Immunology
    Fenclozic acid (ICI-54450) is an orally active anti-inflammatory, analgesic, and antipyretic agent. Fenclozic acid exhibits anti-inflammatory activity in Edadjuvant-induced arthritis and Carrageenin-induced oedema in rats. Fenclozic acid can be used for the research of arthritis .
    Fenclozic acid
  • HY-13219
    Tepoxalin

    		COX Lipoxygenase Reactive Oxygen Species (ROS) NF-κB Neurological Disease Inflammation/Immunology
    Tepoxalin is an orally active dual inhibitor of Cyclooxygenase/Lipoxygenase, with IC50 values of 4.6 μM (sheep cyclooxygenase), 2.85 μM (rat cyclooxygenase), 0.15 μM (rat 5-lipoxygenase), and 3.0 μM (h12-lipoxygenase), respectively. Tepoxalin inhibits ROS production and NF-κB activation. Tepoxalin suppresses the production of thromboxane B2, leukotriene B4, prostaglandins and cytokines, and blocks platelet aggregation. Tepoxalin exhibits potent anti-inflammatory activity in rats with adjuvant-induced arthritis. Tepoxalin possesses analgesic activity. Tepoxalin shows no ulcerogenic activity within the anti-inflammatory dose range. Tepoxalin can be used in studies related to adjuvant-induced arthritis, skin inflammation and Alzheimer's disease .
    Tepoxalin
  • HY-W050088
    Isoxepac

    HP 549

    		 Drug Derivative Neurological Disease Inflammation/Immunology
    Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
    Isoxepac
  • HY-10999R
    Trametinib (Standard)

    GSK1120212 (Standard); JTP-74057 (Standard)

    		 Reference Standards MEK Autophagy Apoptosis Cancer
    Trametinib (Standard) is the analytical standard of Trametinib. This product is intended for research and analytical applications. Trametinib (GSK1120212; JTP-74057) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib activates autophagy and induces apoptosis .
    Trametinib (Standard)
  • HY-W009706
    Alclofenac

    Allopydin; W-7320

    		 Prostaglandin Receptor Neurological Disease Inflammation/Immunology
    Alclofenac (Allopydin) is an orally active prostaglandin synthase inhibitor with anti-inflammatory, analgesic and antipyretic activities. Alclofenac irreversibly inhibits platelet aggregation. Alclofenac can be used in research related to rheumatoid arthritis, osteoarthritis, ankylosing spondylitis, low back pain and sciatica .
    Alclofenac
  • HY-P4191A
    Met-RANTES (human) acetate

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-17484
    Ampiroxicam
    2 Publications Verification

    CP 65703

    		 Drug Derivative Inflammation/Immunology
    Ampiroxicam is an orally active prodrug of non-steroidal anti-inflammatory drug (NSAID). Ampiroxicam inhibits paw swelling in adjuvant-induced arthritis and acute inflammation models, and suppresses phenylbenzoquinone-induced stretching responses in mice. Ampiroxicam is rapidly and completely converted to Piroxicam (HY-B0253) via non-specific esterases and first-pass metabolism. Ampiroxicam induces contact hypersensitivity and photosensitivity reactions through photoproducts generated by UVA. Ampiroxicam can be used in research related to photosensitivity, adjuvant-induced arthritis, rheumatism, osteoarthritis and other inflammatory diseases .
    Ampiroxicam
  • HY-116230
    BI-L-45 XX

    		Ser/Thr Protease Inflammation/Immunology
    BI-L-45 XX is an orally active anti-inflammatory agent. BI-L-45 XX can inhibit the release of neutrophil enzymes and chemotaxis, and is used in the study of adjuvant-induced arthritis .
    BI-L-45 XX
  • HY-120496
    Clofutriben

    ASP3662

    		 11β-HSD Neurological Disease Metabolic Disease
    Clofutriben (ASP3662) is a selective, orally active and brain-penetrant 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1) inhibitor with Ki values of 5.3 nM (human), 2.6 nM (mouse), and 23 nM (rat). Clofutriben inhibits conversion of inactive glucocorticoids to active glucocorticoids, reducing intracellular glucocorticoid exposure. Clofutriben ameliorates neuropathic pain, and restores muscle pressure thresholds in rodent models, while lacking effects in inflammatory pain .
    Clofutriben
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-177091
    AS2795440

    		PIKfyve Interleukin Related MHC Inflammation/Immunology
    AS2795440 is a PIKfyve inhibitor. AS2795440 selectively inhibits proinflammatory cytokine such as IL-12p40 and IL-6 production and B cell activation without affecting Ca 2+ signaling. AS2795440 significantly reduces joint inflammation and bone loss in adjuvant-induced arthritis (AIA) mice model. AS2795440 can be used for inflammatory and autoimmune diseases like rheumatoid arthritis, psoriasis and inflammatory bowel disease research .
    AS2795440
  • HY-W050088S
    Isoxepac-d6

    HP 549-d6

    		 Isotope-Labeled Compounds Drug Derivative Neurological Disease Inflammation/Immunology
    Isoxepac-d6 (HP 549-d6) is the deuterium labeled Isoxepac (HY-W050088). Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
    Isoxepac-d6
  • HY-100754A
    Ritlecitinib malonate

    PF-06651600 malonate

    		 JAK Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (PF-06651600) malonate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib malonate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib malonate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib malonate
  • HY-163756
    NLRP3-IN-43

    		NOD-like Receptor (NLR) Inflammation/Immunology
    NLRP3-IN-43 (compound II-8) is a poteny inhibitor of NLRP3 inflammasome activation that binds to the LRR domain, and disrupts NLRP3-NEK7 interaction .
    NLRP3-IN-43
  • HY-147660
    IMMH001

    		LPL Receptor Inflammation/Immunology
    IMMH001, also called SYL930, is an orally active, potent and selective S1P1 (sphingosine-1-phosphate receptor 1) agonist. IMMH001 decreased levels of both chemokines and proinflammatory cytokines, including IL-1β, IL-5, IL-18, IP10, CCL3, and CCL5. IMMH001 can be used for rheumatoid arthritis (RA) research .
    IMMH001
  • HY-114897
    L-167307

    		p38 MAPK Inflammation/Immunology
    L-167307 is an effective pyrrole-based p38 kinase inhibitor that can reduce secondary paw swelling in rat adjuvant-induced arthritis models .
    L-167307
  • HY-17484R
    Ampiroxicam (Standard)

    CP 65703 (Standard)

    		 Reference Standards Inflammation/Immunology
    Ampiroxicam (Standard) is the analytical standard of Ampiroxicam. This product is intended for research and analytical applications. Ampiroxicam is an orally active prodrug of non-steroidal anti-inflammatory drug (NSAID). Ampiroxicam inhibits paw swelling in adjuvant-induced arthritis and acute inflammation models, and suppresses phenylbenzoquinone-induced stretching responses in mice. Ampiroxicam is rapidly and completely converted to Piroxicam (HY-B0253) via non-specific esterases and first-pass metabolism. Ampiroxicam induces contact hypersensitivity and photosensitivity reactions through photoproducts generated by UVA. Ampiroxicam can be used in research related to photosensitivity, adjuvant-induced arthritis, rheumatism, osteoarthritis and other inflammatory diseases.
    Ampiroxicam (Standard)
  • HY-114873
    LY256548

    LY25684

    		 Phospholipase COX Lipoxygenase Leukotriene Receptor Inflammation/Immunology
    LY256548 (LY25648) is an orally available anti-ischemic and anti-inflammatory compound with central nervous system activity. LY256548 is an inhibitor of phospholipase A2, 5-lipoxygenase (5-LOX), and COX, and inhibits A23187 (HY-N6687)-stimulated leukotriene B4 production. LY256548 inhibits bone damage and paw swelling in the rat Freund's complete adjuvant-induced arthritis (FCA) model .
    LY256548
  • HY-121856
    Flumizole

    		Others Inflammation/Immunology
    Flumizole, a derivative of substituted 5,6-diaryl-2,3-dihydroimidazo[2,1-b]thiazoles, was synthesized and evaluated for its immunoregulatory and anti-inflammatory properties in animal models such as rat adjuvant-induced arthritis and mouse oxazolone-induced contact sensitivity assays. This compound class combines structural elements from flumizole and levamisole, aiming to enhance therapeutic efficacy. Symmetrically substituted 5,6-diaryl compounds with specific alkyl heteroatom or halogen substitutions showed optimal potency in the arthritis model. However, variations in activity were less consistent in the contact sensitivity assay. Flumizole and related compounds demonstrate potential as dual-action agents, targeting inflammation and immune modulation, offering promise for therapeutic development in immune-related disorders .
    Flumizole
  • HY-163412
    IKKβ-IN-3

    		IKK Inflammation/Immunology
    IKKβ-IN-3 (Compound hit4) is a IKKβ inhibitor with an IC50 value of 30.4 nM. IKKβ is a key enzyme in the NF-κB signaling pathway and is involved in the development of many diseases. IKKβ-IN-3 can be used in the study of CAF-induced arthritis .
    IKKβ-IN-3
  • HY-163368
    HDAC6-IN-34

    		HDAC Inflammation/Immunology
    HDAC6-IN-34 (compound 21) is an oral active and selective HDAC6 inhibitor with the IC50 of 18 nM. HDAC6-IN-34 increases the acetylation level of tubulin without affecting histone acetylation in cutaneous T-cell lymphoma cells and inhibits TNF-α secretion in LPS (HY-D1056)-stimulated macrophage cells. HDAC6-IN-34 shows excellent anti-arthritic efficacy in rat .
    HDAC6-IN-34
  • HY-182506
    Azimexon

    BM 12.531

    		 Biochemical Assay Reagents Inflammation/Immunology Cancer
    Azimexon (BM 12.531) is an orally active immunomodulator with radioprotective and antitumor activities. Azimexon prolongs survival in multiple mouse models, enhances immunity and hematopoiesis, and alleviates radiation injury and tumor metastasis. Azimexon causes reversible hemolytic anemia in rats and dogs, and exerts therapeutic activity against adjuvant-induced arthritis in rats. Azimexon can be used for the research of lung carcinoma, leukemia, multiple myeloma, lung tumor, arthritis, breast cancer and AIDS‑related complex .
    Azimexon
  • HY-181513
    DPP-1-IN-2

    		Interleukin Related TNF Receptor Inflammation/Immunology
    DPP-1-IN-2 is a DPP-I inhibitor with a human IC50 of 36.8 nM and oral efficacy. DPP-1-IN-2 binds to intracellular DPP-I, increases its thermal stability, and reduces the activity and expression levels of downstream neutrophil serine proteases by inhibiting its enzymatic activity. DPP-1-IN-2 regulates the secretion of inflammatory factors and chemokines to exert anti-inflammatory effects. DPP-1-IN-2 reverses joint inflammation and tissue damage in adjuvant-induced arthritis rat models. DPP-1-IN-2 is applicable to research related to arthritis .
    DPP-1-IN-2
  • HY-W050088R
    Isoxepac (Standard)

    HP 549 (Standard)

    		 Reference Standards Drug Derivative Neurological Disease Inflammation/Immunology
    Isoxepac (Standard) (HP 549 (Standard)) is the analytical standard of Isoxepac (HY-W050088). This product is intended for research and analytical applications. Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
    Isoxepac (Standard)
  • HY-100754R
    Ritlecitinib (Standard)

    PF-06651600 (Standard)

    		 JAK Reference Standards Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (Standard) is the analytical standard of Ritlecitinib (HY-100754). This product is intended for research and analytical applications. Ritlecitinib (PF-06651600) is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib (Standard)
  • HY-100754CR
    Ritlecitinib tosylate (Standard)

    PF-06651600 tosylate (Standard)

    		 JAK Reference Standards Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (tosylate) (Standard) is the analytical standard of Ritlecitinib (tosylate) (HY-100754C). This product is intended for research and analytical applications. Ritlecitinib (PF-06651600) tosylate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib tosylate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib tosylate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib tosylate (Standard)
  • HY-183918
    Amfenac ethyl ester

    		COX Inflammation/Immunology
    Amfenac ethyl ester is an orally active cyclooxygenase (COX) inhibitor. Amfenac ethyl ester exhibits antiinflammatory activity in rodent models. Amfenac ethyl ester can be used for the research of inflammation .
    Amfenac ethyl ester
  • HY-N19717
    Bartogenic acid

    		NF-κB SOD Inflammation/Immunology Cancer
    Bartogenic acid is an orally active NF-κB inhibitor, found in Barringtonia racemosa fruits. Bartogenic acid increases catalase, superoxide dismutase (SOD), and glutathione levels. Bartogenic acid inhibits lipid peroxidation and suppresses inflammation markers. Bartogenic acid can be used for the research of ovarian cancer, skin cancer, and inflammatory conditions .
    Bartogenic acid

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: