Teduglutide TFA
Based on 2 publication(s) in Google Scholar
Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide TFA can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.
For research use only. We do not sell to patients.
- Formula: C164H252N44O55S.xC2HF3O2
- Molecular Weight:3752.13 (free acid)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Teduglutide TFA
More-
In Vivo Efficacy Study
-
Histological Imaging/Staining
-
IF
-
WB
-
Apoptosis Analysis
All Nuclear Hormone Receptor 4A/NR4A Isoforms
More
Biological Activity
Description
In Vitro
Teduglutide (2.5 μM, 36 h) TFA can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 in human hepatic stellate cells[4]. Teduglutide TFA can increase the proliferation of all intestinal segment epithelial cells and reduce cell apoptosis in the short intestine newborn piglet model[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
-
Cell Line:Human Hepatic Stellate Cells (HSC)
-
Concentration:2.5 μM
-
Incubation Time:36 h
-
Result:Increased transcription levels of NR4a1/Nur77.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Adult male mice undergoing 12-cm ileocecal and cecal resection (ICR)[1].
-
Dosage:0.1 mg/kg
-
Administration:Subcutaneous injection (s.c.); twice daily; 2 weeks
-
Result:Resulted in a decrease in plasma aldosterone concentration, a decrease in fecal water content, and a decrease in fecal sodium loss.
-
Animal Model:A mouse model with lung injury induced by tumor necrosis factor-alpha (TNF-α) and actinomycin D (Act D)[2].
-
Dosage:200 μg/kg
-
Administration:Subcutaneous injection (s.c.); twice daily; 10 days
-
Result:Attenuated structural damage, cell apoptosis, and oxidative stress by reducing lipid peroxidation in mice receiving TNF - α/AtD.
-
Animal Model:Mice fed a high-fat diet (HFD)[3].
-
Dosage:5 μg
-
Administration:Intraperitoneal injection (i.p.); once daily; 4 weeks
-
Result:Reduced the expression of HFD induced pro-inflammatory mediators (NF kB, IL-8, TNF - α, IL-1 β, and IL-6), glial fibrillary acidic protein (GFAP), glial proliferation and neurodegeneration index, stress marker proteins (p-ERK, Hsp60, and i-NOS), and amyloid beta precursor protein (APP).
-
Animal Model:The Mdr2/Abcb4 mouse model of sclerosing cholangitis displaying hepatic inflammation and fibrosis[4].
-
Dosage:0.05 mg/kg
-
Administration:Intraperitoneal injection (i.p.); once daily; 4 weeks
-
Result:Resulted in an increase in intrahepatic level of muricholic acids and serum Fgf15 level, as well as a decrease in mRNA levels of Cyp7a1 and FXR.
Clinical Trial
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
Molecular Weight 3752.13 (free acid)
-
Formula C164H252N44O55S.xC2HF3O2
-
Synonyms
ALX-0600 TFA
-
Sequence
His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
-
Sequence Shortening
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Nat Metab
2025 Apr;7(4):730-741. PMID: 40114026 -
Arch Gerontol Geriatr
GLP-2 ameliorates D-galactose induced muscle aging by IGF-1/Pi3k/Akt/FoxO3a signaling pathway in C2C12 cells and mice. [Abstract]2024 Sep:124:105462. PMID: 38692155
Teduglutide TFA purchased from MedChemExpress. Usage Cited in: Arch Gerontol Geriatr. 2024 Sep:124:105462. [Abstract]
Teduglutide (GLP-2; 300, 600 μg/kg; s.c.; daily for 4 weeks) significantly reduced body weight and muscle strength in the muscle aging in C57BL/6J mice.
Teduglutide TFA purchased from MedChemExpress. Usage Cited in: Arch Gerontol Geriatr. 2024 Sep:124:105462. [Abstract]
Teduglutide (GLP-2; 300, 600 μg/kg; s.c.; daily for 4 weeks) restored the diameter and cross-sectional area of muscle fibers in gastrocnemius muscles of muscle aging in C57BL/6J mice.
Teduglutide TFA purchased from MedChemExpress. Usage Cited in: Arch Gerontol Geriatr. 2024 Sep:124:105462. [Abstract]
Teduglutide (GLP-2; 300, 600 μg/kg; s.c.; daily for 4 weeks) reduced CSA of fast muscle fibers in C57BL/6J mice with muscle aging.
Teduglutide TFA purchased from MedChemExpress. Usage Cited in: Arch Gerontol Geriatr. 2024 Sep:124:105462. [Abstract]
Teduglutide (GLP-2; 300, 600 μg/kg; s.c.; daily for 4 weeks) reduced the protein expression of MuRF-1 and Atrogin-1 in gastrocnemius muscles in the D-gal induced muscle aging in C57BL/6J mice.
Teduglutide TFA purchased from MedChemExpress. Usage Cited in: Arch Gerontol Geriatr. 2024 Sep:124:105462. [Abstract]
Teduglutide (GLP-2; 300, 600 μg/kg; s.c.; daily for 4 weeks) markedly inhibited the percentage of apoptosis cells in gastrocnemius muscles in the D-gal induced muscle aging in C57BL/6J mice.
Teduglutide TFA purchased from MedChemExpress. Usage Cited in: Arch Gerontol Geriatr. 2024 Sep:124:105462. [Abstract]
Teduglutide (GLP-2; 300, 600 μg/kg; s.c.; daily for 4 weeks) increased the protein expression levels of the IGF-1/Pi3k/Akt/FoxO3a in gastrocnemius muscles in the D-gal induced muscle aging in C57BL/6J mice.
Protocols
-
Fibrosis/Collagen Morphometry
Fibrosis and collagen morphometry is based on the quantitative visualization of fibrillar collagen deposition in tissue sections using histochemical stains such as Sirius Red (Picrosirius Red) or Masson's trichrome, followed by image-based or polarization-enhanced analysis to estimate collagen proportional area as a surrogate of extracellular matrix accumulation during fibrotic remodeling. Sirius Red combined with polarized light microscopy enhances detection of collagen fibers due to birefringence properties, enabling more specific visualization of collagen type I and III fibrils compared to conventional bright-field histology, while whole-section or region-restricted digital morphometry reduces field-selection bias in fibrosis assessment. Alternative quantitative approaches include second harmonic generation (SHG) and two-photon excited fluorescence microscopy, which enable label-free detection of fibrillar collagen and have been validated against histological staining and biochemica
-
RNA extraction experimental
By lysing cells, releasing RNA, and removing impurities such as proteins and DNA, high-purity RNA products are finally obtained. The commonly used traditional method is the guanidine isothiocyanate/phenol/chloroform method (Trizol), which is suitable for a variety of animal materials including animal tissues, microorganisms, cultured cells, etc., and most plant materials.
-
Collagen: Sirius Red Staining
Sirius Red or picrosirius red staining is a histochemical method for visualizing collagen-rich extracellular matrix in tissue sections, and collagen fibers are detected as red-stained structures under bright-field microscopy with enhanced birefringence under polarized light. Picrosirius red is useful for assessing total collagen organization, distribution, and fibrosis burden, but polarized color should not be interpreted as a definitive collagen type I versus type III readout because color is affected by fiber orientation, thickness, and packing.
-
Apoptosis
Apoptosis, also called programmed cell death, is generally characterized by distinct morphological characteristics.
-
TUNEL staining for apoptotic DNA fragmentation
TUNEL staining detects DNA strand breaks by using terminal deoxynucleotidyl transferase to add labeled nucleotides to exposed 3′-OH DNA termini, generating either microscopic staining in fixed cells or tissue sections, or fluorescence/cytometric signal in cell suspensions. TUNEL positivity reflects DNA fragmentation but should not be interpreted alone as definitive apoptosis, because TUNEL can also label necrotic, autolytic, mechanically damaged, or DNA-repair-associated DNA breaks.
-
Annexin V plus membrane-impermeant dye apoptosis staining
Annexin V-based apoptosis assays rely on the detection of phosphatidylserine (PS) externalization from the inner leaflet of the plasma membrane to the outer leaflet, an early biochemical hallmark of apoptosis. Fluorescently labeled Annexin V binds PS in a calcium-dependent manner, enabling identification of early apoptotic cells by flow cytometry or fluorescence microscopy. When combined with a membrane-impermeant DNA-binding dye (e. g. , propidium iodide), this approach allows discrimination between viable (Annexin V−/dye−), early apoptotic (Annexin V+/dye−), and late apoptotic or necrotic (Annexin V+/dye+) cell populations by assessing membrane integrity and PS exposure.
-
Connective Tissue: Masson's Trichrome/Collagen Trichrome Staining
Masson’s Trichrome (collagen/trichrome staining) is a histological technique that differentially stains tissue compartments using sequential acidic dyes to distinguish collagen from muscle and cytoplasmic components based on dye affinity and tissue permeability differences, enabling visualization of fibrosis and connective tissue architecture in histological sections. The classical formulation typically uses Weigert's iron hematoxylin for nuclear staining, Biebrich scarlet-acid fuchsin for cytoplasm and muscle, and aniline blue (or light green variants) for collagen, producing a characteristic blue/green collagen signal contrasted against red cytoplasm and dark nuclei. The staining principle relies on selective displacement of smaller dye molecules by larger anionic dyes in collagen-rich regions under controlled acidified conditions, which enhances collagen-specific dye retention. This property makes the method widely used for fibrosis assessment in organs such as heart, liver, lung, a
-
Apoptosis Solutions
Apoptosis is a regulated, generally non-lytic cell-death pathway that removes unwanted, damaged, infected, or abnormal cells through coordinated morphological changes, caspase activation, DNA fragmentation, and membrane remodeling. The intrinsic apoptosis pathway is controlled mainly by mitochondrial outer membrane permeabilization, BCL-2 family proteins, cytochrome c release, apoptosome formation, caspase-9 activation, and downstream executioner caspase-3/7 activation. The extrinsic apoptosis pathway is initiated by death receptors such as Fas, TNFR, and TRAIL receptors, which recruit adaptor proteins and activate caspase-8 before engaging executioner caspases or mitochondrial amplification through BID cleavage. Apoptosis is linked to many phenotypes, including cancer cell killing, tissue homeostasis, immune regulation, neurodegeneration, infection response, and treatment-induced cytotoxicity; unresolved questions include how apoptosis interacts with necroptosis, pyroptosis, ferroptos
-
Research Protocol for Inflammation-related Diseases
The NLRP3 inflammasome is a cytosolic innate immune signaling platform that integrates priming signals and danger-signal activation to promote caspase-1 activation, maturation of IL-1β and IL-18, and gasdermin D-mediated pyroptotic cell death. The core experimental logic is to determine whether inflammatory disease phenotypes are driven by increased NLRP3 expression, ASC-containing inflammasome assembly, caspase-1 cleavage, GSDMD cleavage, and extracellular release of IL-1β/IL-18 rather than by nonspecific cell injury alone. The pathway is strongly linked to inflammation-related disease phenotypes because monosodium urate crystals activate NALP3/NLRP3 inflammasome signaling in gout-like crystal inflammation, cholesterol crystals activate NLRP3 inflammasomes in atherogenesis models, and DSS-induced intestinal inflammation has been reported to involve NLRP3 inflammasome activity. However, experimental colitis studies also show context-dependent protective effects of NLRP3 inflammasome co
-
Inhalation Toxicity Study
Inhalation toxicity studies expose rodents to a controlled aerosol, vapor, gas, or smoke atmosphere and assess respiratory and systemic toxicity using exposure-atmosphere characterization, clinical observations, body and organ weights, bronchoalveolar lavage fluid, histopathology, blood chemistry, hematology, and, when included, molecular endpoints such as transcriptomics, proteomics, lipidomics, or tissue burden analysis. The primary biological readouts are airway irritation, pulmonary inflammation, cytotoxicity, altered surfactant or lipid homeostasis, impaired particle clearance, and tissue remodeling, reflected by BALF cell differentials, BALF protein, LDH, phosphatase activities, cytokines, lung weight, microscopic respiratory-tract lesions, and retained lung burden.
-
Research Protocol for Neurological Diseases
PINK1/Parkin-mediated mitophagy pathway is a mitochondrial quality-control signaling axis in which mitochondrial depolarization stabilizes PINK1 on damaged mitochondria, activates Parkin recruitment and E3 ubiquitin ligase activity, promotes ubiquitination of outer mitochondrial membrane proteins, recruits selective autophagy adaptors, and drives lysosomal degradation of damaged mitochondria. In neurological disease research, this pathway is experimentally important because neurons, especially dopaminergic neurons, are highly dependent on mitochondrial integrity, and defective mitochondrial turnover can lead to mitochondrial dysfunction, oxidative stress, impaired neuronal survival, α-synuclein accumulation, and neuroinflammatory damage-associated signals. The genetic disease link is strongest in Parkinson’s disease because mutations in PRKN/parkin cause autosomal recessive juvenile parkinsonism, mutations in PINK1 cause hereditary early-onset Parkinson’s disease, and Drosophila studie
-
Research Protocol for Metabolic Diseases
AMP-activated protein kinase, AMPK, is a conserved cellular energy sensor that responds to reduced cellular energy status and coordinates metabolism by increasing ATP-generating catabolic pathways while suppressing ATP-consuming anabolic processes. In metabolic disease research, the AMPK pathway is experimentally relevant because it regulates hepatic lipid synthesis, fatty acid oxidation, glucose production, skeletal-muscle glucose disposal, mTORC1-linked biosynthesis, autophagy, mitochondrial homeostasis, and whole-body energy balance. The central pathway logic is that energy stress, metformin, exercise-like stimulation, or direct AMPK activators increase AMPKα Thr172 phosphorylation and downstream substrate phosphorylation, including ACC and RAPTOR. Phosphorylation of ACC suppresses lipogenesis and supports fatty acid oxidation, whereas phosphorylation of RAPTOR suppresses mTORC1 signaling and links cellular energy status to growth and protein synthesis control. The pathway is linked
Purity & Documentation
References
[1]. Reiner J, et al. Teduglutide Promotes Epithelial Tight Junction Pore Function in Murine Short Bowel Syndrome to Alleviate Intestinal Insufficiency. Dig Dis Sci. 2020 Dec;65(12):3521-3537. [Content Brief]
[2]. Arda-Pirincci P, et al. Teduglutide, a glucagon-like peptide 2 analogue: a novel protective agent with anti-apoptotic and anti-oxidant properties in mice with lung injury. Peptides. 2012 Dec;38(2):238-47. [Content Brief]
[3]. Nuzzo D, et al. Glucagon-like peptide-2 reduces the obesity-associated inflammation in the brain. Neurobiol Dis. 2019 Jan;121:296-304. [Content Brief]
[4]. Fuchs CD, et al. GLP-2 Improves Hepatic Inflammation and Fibrosis in Mdr2-/- Mice Via Activation of NR4a1/Nur77 in Hepatic Stellate Cells and Intestinal FXR Signaling. Cell Mol Gastroenterol Hepatol. 2023;16(5):847-856. [Content Brief]
[5]. Naberhuis JK, et al. Teduglutide-Stimulated Intestinal Adaptation Is Complemented and Synergistically Enhanced by Partial Enteral Nutrition in a Neonatal Piglet Model of Short Bowel Syndrome. JPEN J Parenter Enteral Nutr. 2017 Jul;41(5):853-865. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)