CCR1 Antagonist
-
CCR1 Antagonist (17)
- 1
- BX471
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Abaucin
0 ImagesSynonyms: RS102895; MLJS-21001 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- BX471 hydrochloride
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Abaucin hydrochloride
0 ImagesSynonyms: RS102895 hydrochloride; MLJS-21001 hydrochloride -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
J-113863
0 ImagesCat. No.: HY-103360CAS No.: 353791-85-2J-113863 is a potent and selective CCR1 antagonist with IC50 values of 0.9 nM and 5.8 nM for human and mouse CCR1 receptors, respectively. J-113863 is also a potent antagonist of the human CCR3 (IC50 of 0.58 nM) , but a weak antagonist of the mouse CCR3 (IC50 of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
YM022
0 ImagesYM022 is a highly potent, selective and orally active gastrin/cholecystokinin (CCK)-B receptor (CCK-BR) antagonist. YM022 shows the Ki values of 68 pM and 63 nM for CCK-B and CCK-A receptor, respectively. YM022 can inhibit gastrin-induced gastric acid secretion and histidine decarboxylase activation in vivo.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Met-RANTES (human) acetate
0 ImagesCat. No.: HY-P4191APurity: 99.39%Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA).
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- CCX354
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
BMS-817399
0 ImagesBMS-817399 is a potent, selective, and orally bioavailable CCR1 antagonist. BMS-817399 exhibits CCR1 binding affinity and chemotaxis inhibition potencies of 1 and 6 nM (IC50), respectively. BMS-817399 can be used for the research of rheumatoid arthritis.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
BI 639667
0 ImagesSynonyms: CCR1 antagonist 8 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CCR1 antagonist 9
0 ImagesCCR1 antagonist 9 is a potent and selective CCR1 antagonist with an IC50 of 6.8 nM in calcium flux assay.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Met-RANTES (human)
0 ImagesCat. No.: HY-P4191CAS No.: 1883816-50-9Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CCR1 antagonist 10
0 ImagesCat. No.: HY-15544CAS No.: 1010731-97-1CCR1 antagonist 10 (example 1) is a potent and orally active CCR1 antagonist. CCR1 antagonist 10 inhibits 125I-MIP-1α binding to THP-1 cell membranes with an Ki value of 2.3 nM.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CP-481715
0 ImagesCat. No.: HY-12079CAS No.: 212790-31-3CP-481715 is a potent, reversible and selective CCR1 antagonist with a Kd of 9.2 nM for human CCR1. CP-481715 is >100-fold selective for CCR1 as compared with a panel of G-protein-coupled receptors including related chemokine receptors. CP-481715 has the potential for rheumatoid arthritis and other inflammatory diseases research.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CCR1 antagonist 12
0 ImagesCat. No.: HY-124668CAS No.: 921208-19-7CCR1 antagonist 12 (Compound 12) is an antagonist for CCR1 with IC50 of 3 nM for human CCR1. CCR1 antagonist 12 inhibits CCL3-induced transwell chemotaxis with an IC50 of 0.009 µM. CCR1 antagonist 12 exhibits good pharmacokinetic characters in rats model.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CCR1 antagonist 13
0 ImagesCat. No.: HY-124668ACAS No.: 868408-20-2CCR1 antagonist 13 is a selective CCR1 small molecule antagonist.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CP-865569
0 ImagesCat. No.: HY-171476CAS No.: 478833-25-9CP-865569 is a CCR1 antagonist. CP-865569 can be used in the research of inflammatory diseases and autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis.
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- 1