GM-CSF Protein, Rat (CHO)
Based on 1 Customer Validation
GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.
- Species: Rat
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.
Background
Granulocyte-macrophage colony-stimulating factor (GM-CSF) is produced by a variety of cell types including T cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. It is an important hematopoietic growth factor and immune modulator. GM-CSF also has profound effects on the functional activities of various circulating leukocytes. GM-CSF stimulates multipotent progenitor cells depending on its concentration, the proliferation of macrophage progenitors at the lowest doses, followed by granulocyte, erythroid, eosinophil, megakaryocyte and multipotent progenitors. It also stimulates the differentiation of myeloid leukemic cells and controls eosinophil function in some instances[1][2]. GM-CSF also enhances the functionality of mature cells, such as neutrophils. In neutrophils, GM-CSF potentiates degranulation, the release of oxygen and nitrogen radical ions, phagocytosis, and inhibits apoptosis[3]. GM-CSF inhibition in some animal models of autoimmune diseases showed significant beneficial effects[4]. GM-CSF also has many pro-inflammatory functions and recent data implicates GM-CSF as a key factor in Th17 driven autoimmune inflammatory conditions[5].
Verified Bioactivity
1.The ED50 is <5 pg/mL as measured by FDC-P1 cells, corresponding to a specific activity of >2 × 108 units/mg.
2.Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 5.019 pg/mL, corresponding to a specific activity is 1.99×108 units/mg.
3.Recombinant Mouse GM-CSF R alpha immobilized on CM5 Chip can bind Rat GM-CSF with an affinity constant of 1.0-10.0 nM as determined in a SPR assay.
Technical Parameters
-
Species Rat
-
Source CHO
-
Tag Tag Free
-
Accession
P48750 (A18-K144)
-
Molecular Construction
-
N-term
-
GM-CSF (A18-K144)
Accession # P48750 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CSF2; Molgramostim; Colony Stimulating Factor 2; Molgramostin; GMCSF; CSF; Sargramostim; Granulocyte-Macrophage Colony Stimulating Factor; GM-CSF; Granulocyte Macrophage-Colony Stimulating Factor; Colony Stimulating Factor 2 (Granulocyte-Macrophage); Colo
-
AA Sequence
APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
-
Predicted Molecular Mass
14.6 kDa
-
Molecular Weight
Approximately 16-26 kDa, based on SDS-PAGE under non reducing (N) conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16(2):126-33. [Content Brief]
[2]. Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF): regulation of expression. Prog Clin Biol Res. 1990;338:27-41. [Content Brief]
[3]. Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171(12):6846-55. [Content Brief]
[4]. Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8. [Content Brief]
[5]. van Nieuwenhuijze A, et al. GM-CSF as a therapeutic target in inflammatory diseases. Mol Immunol. 2013 Dec;56(4):675-82. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
