GM-CSF Protein, Mouse (CHO)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

GM-CSF Protein, Mouse (CHO) is a hematopoietic growth factor and immune modulator.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

GM-CSF Protein, Mouse (CHO) is a hematopoietic growth factor and immune modulator.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF) is produced by a variety of cell types including T cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. It is an important hematopoietic growth factor and immune modulator. GM-CSF also has profound effects on the functional activities of various circulating leukocytes. GM-CSF stimulates multipotent progenitor cells depending on its concentration, the proliferation of macrophage progenitors at the lowest doses, followed by granulocyte, erythroid, eosinophil, megakaryocyte and multipotent progenitors. It also stimulates the differentiation of myeloid leukemic cells and controls eosinophil function in some instances[1][2]. GM-CSF also enhances the functionality of mature cells, such as neutrophils. In neutrophils, GM-CSF potentiates degranulation, the release of oxygen and nitrogen radical ions, phagocytosis, and inhibits apoptosis[3]. GM-CSF inhibition in some animal models of autoimmune diseases showed significant beneficial effects[4]. GM-CSF also has many pro-inflammatory functions and recent data implicates GM-CSF as a key factor in Th17 driven autoimmune inflammatory conditions[5].

Verified Bioactivity

1.The ED50 is 21.54 pg/mL as measured by mouse FDC-P1 cells, corresponding to a specific activity of 4.643 × 107 units/mg.
2.Measured in a cell proliferation assay using THP 1 cells. The ED50 for this effect is 21.54 pg/mL, corresponding to a specific activity is 4.643×107 units/mg.
3. Measured by its binding ability in a functional ELISA. Immobilized Mouse GM-CSF at 5 μg/mL (100 μL/well) on the plate can bind Mouse GM-CSF R alpha. The ED50 for this effect is 0.1-0.5 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using THP 1 cells. The ED50 for this effect is 21.54 pg/mL, corresponding to a specific activity is 4.643×107 units/mg.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GM-CSF (A18-K141)
      Accession # Q14AD9
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CSF2; Molgramostim; Colony Stimulating Factor 2; Molgramostin; GMCSF; CSF; Sargramostim; Granulocyte-Macrophage Colony Stimulating Factor; GM-CSF; Granulocyte Macrophage-Colony Stimulating Factor; Colony Stimulating Factor 2 (Granulocyte-Macrophage); Colony-Stimulating Factor; Granulocyte-Macrophage Colony-Stimulating Factor

  • AA Sequence

    APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

  • Predicted Molecular Mass

    14.2 kDa

  • Molecular Weight

    Approximately 15-19 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00