DCIP-1/CXCL3 Protein, Mouse
Based on 3 publication(s) in Google Scholar
CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. DCIP-1/CXCL3 Protein, Mouse is produced in E. coli , and consists of 73 amino acids (A28-S100).
- Species: Mouse
- Source: E. coli
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Technical Parameters
-
Product Properties
- Documentation
- Références
- Help & FAQs
Activité biologique
CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. DCIP-1/CXCL3 Protein, Mouse is produced in E. coli , and consists of 73 amino acids (A28-S100).
CXCL3 is also known as MIP-2 beta, or DCIP-1 in mouse, CINC2 in rat, and GRO-gamma in humans. CXCL3 is a member of the CXC chemokine subfamily, and it is subclassified as a Glu-Leu-Arg (ELR+) CXC chemokine. CXCL3 is originally identified in the supernatants of melanoma cell lines in culture, and is referred to as GRO (growth-related oncogene)[1]. Previous studies have reported that CXCL3 is produced by macrophages, osteoblasts, airway epithelium, dendritic cells, synovial fibroblasts, and cancers[2].
The amino acid sequence of human CXCL3 protein has low homology between mouse and rat CXCL3 protein.
CXCL3 plays an important role in leukocyte chemotaxis, angiogenesis, tumorigenesis, and cell invasion. CXCL3 exerts its functions through a number of signaling pathways including p38 MAPK, ERK1/2 MAPK and JAK2/STAT3 etc., by activating CXCR2 receptor. CXCL3 is highly expressed during the number of tumorous conditions including melanoma, prostate, colorectal, aggressive breast cancer tumors, hepatocellular carcinoma (HCC) and also during hepatic injury and inflammation[3][4].
The cancer types affected by the action of CXCL3 (along with CXCL1 and CXCL2) include prostate cancer, pancreatic cancer, melanoma, lung cancer, hepatocellular carcinoma, and gastric cancer[1]. CXCL3 facilitates adipogenic differentiation through ERK- and JNK-induced induction of c/ebpb and c/ebpd by autocrine/paracrine manners in adipocytes[2]. Furthermore, CXCL3 is also associated with vascular invasion and tumor capsule formation[3]. CXCL3 plays a role in asthma severity and asthmatic airway remodeling[5].
1. Full biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of <100 ng/mL.
2. Measured in a cell proliferation assay using HUVEC human ureteral epithelial cell. The ED50 this effect is 1.747 ng/ml, corresponding to a specific activity is 5.724×105 units/mg.
-
Measured in a cell proliferation assay using HUVEC human ureteral epithelial cell. The ED50 for this effect is 1.747 ng/mL, corresponding to a specific activity is 5.724×105units/mg.
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Int J Biol Sci
CXCR4-dependent macrophage-to-fibroblast signaling contributes to cardiac diastolic dysfunction in heart failure with preserved ejection fraction. [Abstract]2022 Jan 9;18(3):1271-1287. PMID: 35173552 -
NPJ Regen Med
2024 Sep 20;9(1):24. PMID: 39304660 -
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q6W5C0 (A28-S100)
-
Molecular Construction
-
N-term
-
CXCL3 (A28-S100)
Accession # Q6W5C0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rMuCXCL3; C-X-C motif chemokine 3; Dendritic cell inflammatory protein 1; DCIP-1
-
AA Sequence
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
-
Predicted Molecular Mass
7.9 kDa
-
Masse moléculaire
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Pureté
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Niradiz Reyes, et al. CXCL3 Signaling in the Tumor Microenvironment. Adv Exp Med Biol. 2021;1302:15-24. [Content Brief]
[2]. Smith DF, et al. GRO family chemokines are specialized for monocyte arrest from flow. Am J Physiol Heart Circ Physiol. 2005 Nov;289(5):H1976-84. [Content Brief]
[3]. Joji Kusuyama, et al. CXCL3 positively regulates adipogenic differentiation. J Lipid Res. 2016 Oct;57(10):1806-1820. [Content Brief]
[4]. Farioli-Vecchioli S, et al. Tis21 knock-out enhances the frequency of medulloblastoma in Patched1 heterozygous mice by inhibiting the Cxcl3-dependent migration of cerebellar neurons.J Neurosci. 2012 Oct 31;32(44):15547-64. [Content Brief]
[5]. Khushboo Gulati, et al. Molecular cloning and biophysical characterization of CXCL3 chemokine. Int J Biol Macromol. 2018 Feb;107(Pt A):575-584. [Content Brief]
[6]. Jinru Weng, et al. CXCL3 overexpression affects the malignant behavior of oral squamous cell carcinoma cells via the MAPK signaling pathway. J Oral Pathol Med. 2021 Oct;50(9):902-910. [Content Brief]
[7]. Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191(5):2731-41. [Content Brief]
[8]. Manuela Ceccarelli, et al. Suppression of Medulloblastoma Lesions by Forced Migration of Preneoplastic Precursor Cells with Intracerebellar Administration of the Chemokine Cxcl3. Front Pharmacol. 2016 Dec 16;7:484. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
