IP-10/CRG-2/CXCL10 Protein, Mouse

1 Cited Publications
Kundenbewertung

Based on 1 publication(s) in Google Scholar

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. IP-10/CRG-2/CXCL10 Protein, Mouse consists of 77 amino acids (I22-P98) and is expressed in E. coli.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
  • Species: Mouse
  • Source: E. coli
  • Speicherung:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biologische Aktivität
  • Technical Parameters
  • Product Properties
  • Documentation
  • Verweise
  • Help & FAQs

Biologische Aktivität

Beschreibung

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CRG-2/CXCL10 Protein, Mouse consists of 77 amino acids (I22-P98) and is expressed in E. coli.

Background

CXCL10 is a pro-inflammatory chemokine secreted by a wide spectrum of cells. CXCL10 activates T lymphocytes (Th1), NK cells, macrophages, dendritic and B cells. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, angiogenesis, immune dysfunction and tumor development[1].
Mature human CXCL10 shares 68% amino acid sequence identity with mouse and rat CXCL10.
Human CXCL10 gene, is initially isolated in 1985 by Luster while treating a lymphoma cell line (U937) with recombinant IFN-γ. CXCL10 cDNA has an open reading frame of 1173-bp containing 4 exons and encoding a protein of 98-amino acids. The primary translational product of the CXCL10 gene is a 12 kDa protein containing two internal disulfide cross bridges. CXCL10 exerts its biological effects by binding to CXCR3, a seven trans-membrane-spanning G protein-coupled receptor in a paracrine or autocrine fashion, which is predominantly expressed on activated T, B lymphocyte, natural killer (NK), dendritic and macrophage cells. CXCL10 induction depends predominantly on the carboxyl-terminal region of CXCR3, which is essential for CXCR3 internalization, chemotaxis and calcium mobilization induced by the CXCL10 ligand. The powerful chemotactic action of CXCL10 on activated lymphocytes allows it to modulate both innate and adaptive immunity, inducing tissue damage and modulating tumor formation[1].
  CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. ELR-negative CXCL10 is an angiostatic chemokine, which inhibits angiogenesis. Abnormal levels of CXCL10 have been observed in body fluids of individuals infected with viruses, bacteria, fungi and parasites[1].

In Vitro

Recombinant mouse CXCL10 protein (1, 10, or 100 ng/mL; for 72 h) shows strongly chemotactic to the astrocytes[4].

In Vivo

Mice are pretreated with recombinant mouse CXCL10 (2 mg/kg/day, i.v.) or vehicle for 3 days, and injected with BrdU 24 h after final pretreatment. CXCL10 inhibits crypt cell proliferation and migration in vivo[2].
In Bleomycin-treated mice, recombinant mouse CXCL10 (1 μg/20 μL; daily; for 13 days) is given to mice intramuscularly daily. CXCL10 inhibits primary lung fibroblast migration during fibrosis in WT mice, but not in Sdc4–/– mice[3].

Verified Bioactivity

1.Full biological activity determined by a chemotaxis bioassay using human peripheral blood lymphocytes is in a concentration range of 0.1-10.0 ng/ml in the presence of IL-2.
2.Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR3. The ED50 for this effect is 0.2587 µg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL10 (I22-P98)
      Accession # P17515
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL10; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 10; Prev. SCYB10; Small-Inducible Cytokine B10; Prev. INP10; C-X-C Motif Chemokine 10; IP-10; Protein 10 From Interferon (Gamma)-Induced Cell Line; GIP-10; Interferon-Inducible Cytokine IP-1

  • AA Sequence

    IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

  • Predicted Molecular Mass

    8.7 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Reinheit

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 2×PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Verweise

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Verdünnungsrechner

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Konzentration (Stammlösung) Konzentration (Stammlösung)
×
Volumen (Stammlösung) Volumen (Stammlösung)
=
Konzentration (Ziellösung) Konzentration (Ziellösung)
×
Volumen (Ziellösung) Volumen (Ziellösung)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Angebot einholen Auf Lager

Other size
Angebot einholen
Please select quantity
Amount: USD 0.00