Crotamine TFA
Based on 1 Customer Validation
Crotamine TFA is a Na+ channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza : 98.42%
- Fòrmula: C214H326N64O54S7.xC2HF3O2
- Peso molecular:4883.73 (free base)
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Actividad biológica
Descripciòn
Chemical Information
-
Appearance Solid
-
Peso molecular 4883.73 (free base)
-
Fòrmula C214H326N64O54S7.xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Lys-Gln-Cys-His-Lys-Lys-Gly-Gly-His-Cys-Phe-Pro-Lys-Glu-Lys-Ile-Cys-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys-Arg-Trp-Arg-Trp-Lys-Cys-Cys-Lys-Lys-Gly-Ser-Gly (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)
-
Sequence Shortening
YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Disulfide bonds:Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvente y solubilidad
In Vitro:
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Pureza y Documentación
-
Ficha de datos (295 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Nicastro G, et al. Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003 May;270(9):1969-79. [Content Brief]
[2]. Kerkis I, et al. Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010 Dec;19(12):1515-25. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)