CTACK/CCL27 Protein, Human
Based on 1 publication(s) in Google Scholar
CTACK/CCL27 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CTACK/CCL27 Protein, Human a recombinant human CTACK/CCL27 (F25-G112) protein expressed by E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
CTACK/CCL27 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CTACK/CCL27 Protein, Human a recombinant human CTACK/CCL27 (F25-G112) protein expressed by E. coli[1][2].
CCL27, also known as skin T-cell attracting chemokine (CTACK), is a CC chemokine located on chromosome 9 in the human genome.CCL27 is abundantly expressed in basal keratin-forming cells. Expression is lowest in basal suprabasal keratin-forming cells of normal skin; however, they exhibit stronger CCL27 expression in lesions of human AD, contact dermatitis, and psoriasis. In addition, CCL27 is present in the dermal extracellular matrix (ECM) of the epidermal plexus, fibroblasts and endothelial cells, especially in inflamed skin . By binding to chemokine receptor 10 (CCR10), CCL27 regulates inflammation by promoting the migration of lymphocytes into the skin. CCL27 contributes to tissue-restricted leukocyte trafficking by exhibiting high receptor and tissue specificity, and induces inflammation by promoting lymphocyte migration into the skin.CCL27 induces expression of cultured normal human keratinocytes (NHEK) via the pro-inflammatory factors TNFα and IL-1[1][2].
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Inflamm Res
Screening of Diagnostic Biomarkers and Immune Infiltration Characteristics Linking Rheumatoid Arthritis and Rosacea Based on Bioinformatics Analysis. [Abstract]2024 Aug 1:17:5177-5195. PMID: 39104909
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y4X3 (F25-G112)
-
Molecular Construction
-
N-term
-
CCL27 (F25-G112)
Accession # Q9Y4X3 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL27; CC Chemokine ILC; Prev. SCYA27; Cutaneous T-Cell Attracting Chemokine; CTACK; IL-11 R-Alpha-Locus Chemokine; ILC; IL-11 Ralpha-Locus Chemokine; Skinkine; Small-Inducible Cytokine A27; ESkine; C-C Motif Chemokine 27; PESKY; Cutaneous T-Cell-Attracti
-
AA Sequence
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
-
Predicted Molecular Mass
10.1 kDa
-
Molecular Weight
Approximately 6-12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, pH 7.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Lin Chen, et al. CCL27 is a critical factor for the development of atopic dermatitis in the keratin-14 IL-4 transgenic mouse model. Int Immunol. 2006 Aug;18(8):1233-42. [Content Brief]
[2]. Jette Lindorff Riis, et al. CCL27 expression is regulated by both p38 MAPK and IKKβ signalling pathways. Cytokine. 2011 Dec;56(3):699-707. [Content Brief]
[3]. Bernhard Homey, et al. CCL27-CCR10 interactions regulate T cell-mediated skin inflammation. Nat Med. 2002 Feb;8(2):157-65. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
