1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. CCL27 Protein, Human

CCL27 Protein, Human

Cat. No.: HY-P7767
Handling Instructions

CCL27 Protein, Human is a skinspecific CC-chemokine continuously expressed by epidermal keratinocytes.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $185 Ask For Quote & Lead Time
50 μg $560 Ask For Quote & Lead Time

* Please select Quantity before adding items.

CCL27 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Accession

Q9Y4X3 (F25-G112)

Gene ID

10850

Synonyms
rHuCCL27; C-C Motif Chemokine 27; CC Chemokine ILC; Cutaneous T-Cell-Attracting Chemokine; CTACK; Eskine; IL-11 R-Alpha-Locus Chemokine; Skinkine; Small-Inducible Cytokine A27; CCL27; ILC; SCYA27
AA Sequence

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Molecular Weight

Approximately 14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 500 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CCL27/CTACK (cutaneous T-cell-attracting chemokine) specifically binds the chemokine receptor 10 (CCR10), which is expressed almost exclusively on skin homing CLA+ lymphocytes. Through binding to the chemokine receptor 10 (CCR10), CCL27 mediates inflammation by promoting lymphocyte migration into the skin. CCL27 contributes to a tissuerestricted leucocyte trafficking by exhibiting high receptor and tissue specificity and induces inflammation by promoting lymphocyte migration into the skin. The expression of CCL27 is inducible in cultured normal human keratinocytes (NHEK) by the pro-inflammatory cytokines TNFα and IL-1[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL27 Protein, Human
Cat. No.:
HY-P7767
Quantity:
MCE Japan Authorized Agent: