1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. TNF Superfamily T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily Fas/CD95
  5. Fas/CD95 Protein, Human (HEK293)

Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD). Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases. Human Fas receptor contain a death domain (230-314 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Human (HEK293) has a full length of 157 amino acids (Q26-S172), produced in HEK293 cells with tag free.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
10 μg Auf Lager
50 μg Auf Lager
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

  • Verweise

Beschreibung

Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD)[1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Human Fas receptor contain a death domain (230-314 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Human (HEK293) has a full length of 157 amino acids (Q26-S172), produced in HEK293 cells with tag free.

Background

Fas receptor is the receptor for TNFSF6/FASLG, also known as apoptosis-mediating surface antigen FAS and Apo-1 antigen. It is a cell-surface protein that mediates apoptosis upon ligation with Fas ligand. Fas receptor belongs to tumor necrosis factor receptor superfamily, there are 7 isoforms produced by alternative splicing, some of which are candidates for nonsense-mediated mRNA decay (NMD). The Fas gene is expressed in several tissues in human and mouse, including thymus, spleen, ovary and heart, and on a number of cell types, including activated T- and B-lymphocytes. Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6[1]. Fas receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. It interacts with its ligand to allow the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10[2]. To be specific, the autoproteolytic processing of the caspase in the complex triggers a downstream caspase cascade, including activation of the acidic sphingomyelinase, consumption of sphingomyelin, release of ceramide, and subsequent activation of JNK and p38-K. Thus, Fas receptor acts fucntion via caspase’s regulation and leads to apoptosis[3]. Moreover, the signaling initiated from Fas is mediated by mitogen activated protein kinases (MAPKs) including extracellular-signal-regulated kinase (ERK) and c-Jun N-terminal kinase (JNK) which induce subsequent activation of NF-κB. Meanwhile, stimulation of Fas induced the expression of pro-inflammatory mediators such as matrix metalloproteinase (MMP)-9 and IL-8[4]. The amino acid sequence of human Fas protein has low homology with that of rat and mouse, and the similarity rate is 49.54% and 48.93%, respectively.

In Vitro

Fas (CD95) induces proinflammatory cytokine responses by human monocytes and monocyte-derived macrophages[5].

Biologische Aktivität

The ED50 is <0.4 μg/mL as measured by Jurkat cells, corresponding to a specific activity of >1.0 × 106 units/mg.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P25445 (Q26-S172)

Gene ID

355  [NCBI]

Molecular Construction
N-term
Fas (Q26-S172)
Accession # P25445
C-term
Protein Length

Extracellular Domain

Synonyms
rHuFASR/TNFRSF6; Tumor necrosis factor receptor superfamily member 6; Fas receptor; CD95; APT1; FAS1; Apo-1
AA Sequence

QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS

Molekulargewicht

Approximately 17-29 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Reinheit

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation
Verweise
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Fas/CD95 Protein, Human (HEK293)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Fas/CD95 Protein, Human (HEK293)
Art. -Nr.:
HY-P7168
Menge:
MCE Japan Authorized Agent: