1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Receptors
  5. Fas/CD95 Protein, Human

Fas/CD95 Protein, Human

Cat. No.: HY-P7169
Handling Instructions

Fas/CD95 Protein, Human belongs to the subgroup of the tumor necrosis factor receptor (TNF-R) family that can trigger apoptosis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Fas/CD95 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P25445 (R17-N173)

Gene ID

355

Synonyms
rHuFASR/TNFRSF6; Tumor necrosis factor receptor superfamily member 6; Fas receptor; CD95; APT1; FAS1; Apo-1
AA Sequence

RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN

Molecular Weight

Approximately 17.6 kDa

Biological Activity
The ED50 is 10-15 μg/mL as measured by Jurkat cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Human FasR cDNA encodes a 325 amino acid (aa) residue type 1 membrane protein that belongs to the TNF and NGF receptor family[1]. FAS belongs to the subgroup of the tumor necrosis factor receptor (TNF-R) family that contain an intra-cellular ‘death domain’ and can trigger apoptosis[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fas/CD95 Protein, Human
Cat. No.:
HY-P7169
Quantity:
MCE Japan Authorized Agent: