CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST)
Based on 1 Customer Validation
CSNK2A2 is the catalytic subunit of the serine/threonine protein kinase complex. It regulates important processes such as cell cycle, apoptosis, and transcription, and affects viral infection. During mitosis, CSNK2A2 maintains CDK1 activity and induces cell cycle arrest. In addition, CSNK2A2 phosphorylates p53/TP53 and negatively regulates apoptosis. It widely affects cell signaling, phosphorylated caspases, the apoptotic factor NOL3, and RNA polymerase, among others. CSNK2A2 also regulates Wnt signaling and acts as a kinase for extracellular proteins. CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST) is the recombinant human-derived CK2 alpha/CSNK2A2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CSNK2A2 is the catalytic subunit of the serine/threonine protein kinase complex. It regulates important processes such as cell cycle, apoptosis, and transcription, and affects viral infection. During mitosis, CSNK2A2 maintains CDK1 activity and induces cell cycle arrest. In addition, CSNK2A2 phosphorylates p53/TP53 and negatively regulates apoptosis. It widely affects cell signaling, phosphorylated caspases, the apoptotic factor NOL3, and RNA polymerase, among others. CSNK2A2 also regulates Wnt signaling and acts as a kinase for extracellular proteins. CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST) is the recombinant human-derived CK2 alpha/CSNK2A2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
CSNK2A2, the catalytic subunit of a constitutively active serine/threonine-protein kinase complex, plays a pivotal role in phosphorylating a diverse array of substrates with acidic residues located C-terminal to the phosphorylated serine or threonine. This versatile protein regulator is involved in regulating critical cellular processes, including cell cycle progression, apoptosis, and transcription, as well as influencing viral infection. Acting as a central regulatory node, CSNK2A2 integrates and coordinates various signals, orchestrating an appropriate cellular response. During mitosis, it functions within the p53/TP53-dependent spindle assembly checkpoint, preserving cyclin-B-CDK1 activity and inducing G2 arrest in response to spindle damage. Furthermore, CSNK2A2 is essential for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 after UV irradiation, and it exerts a negative regulatory effect on apoptosis. Notably, CSNK2A2 displays a broad impact on cellular signaling, phosphorylating caspases, apoptotic regulator NOL3, RNA polymerases, and numerous transcription factors. Its influence extends to molecular chaperones, such as Hsp90 and its co-chaperones, highlighting its essential role in chaperone function. Additionally, CSNK2A2 regulates Wnt signaling, acts as an ectokinase for extracellular proteins, and exerts its influence during viral infection by phosphorylating proteins involved in the life cycles of various viruses, underscoring its multifaceted and crucial role in cellular homeostasis.
Verified Bioactivity
The specific activity was determined to be ≤30 nmol/min/mg using casein as substrate.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P19784 (M1-R350)
-
Molecular Construction
-
N-term
-
His-GST
-
CSNK2A2 (M1-R350)
Accession # P19784 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CSNK2A2; Casein Kinase 2 Alpha'; Casein Kinase 2 Alpha 2; CK II Alpha'; CK2alpha'; CK2A2; CSNK2A1; Non-Specific Serine/Threonine Protein Kinase; Casein Kinase 2, Alpha Prime Polypeptide; Casein Kinase II Subunit Alpha; Casein Kinase II Subunit Alpha'; CK II Alpha
-
AA Sequence
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
-
Predicted Molecular Mass
69 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, pH 8.5, 10% glycerol, 0.5 mM TCEP, 0.5 mM PMSF.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)