1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. CK2
  5. CSNK2A2/CK2a2
  6. CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST)

CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST)

Cat. No.: HY-P76297
Handling Instructions Technical Support

CSNK2A2 is the catalytic subunit of the serine/threonine protein kinase complex. It regulates important processes such as cell cycle, apoptosis, and transcription, and affects viral infection. During mitosis, CSNK2A2 maintains CDK1 activity and induces cell cycle arrest. In addition, CSNK2A2 phosphorylates p53/TP53 and negatively regulates apoptosis. It widely affects cell signaling, phosphorylated caspases, the apoptotic factor NOL3, and RNA polymerase, among others. CSNK2A2 also regulates Wnt signaling and acts as a kinase for extracellular proteins. CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST) is the recombinant human-derived CK2 alpha/CSNK2A2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CSNK2A2 is the catalytic subunit of the serine/threonine protein kinase complex. It regulates important processes such as cell cycle, apoptosis, and transcription, and affects viral infection. During mitosis, CSNK2A2 maintains CDK1 activity and induces cell cycle arrest. In addition, CSNK2A2 phosphorylates p53/TP53 and negatively regulates apoptosis. It widely affects cell signaling, phosphorylated caspases, the apoptotic factor NOL3, and RNA polymerase, among others. CSNK2A2 also regulates Wnt signaling and acts as a kinase for extracellular proteins. CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST) is the recombinant human-derived CK2 alpha/CSNK2A2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

CSNK2A2, the catalytic subunit of a constitutively active serine/threonine-protein kinase complex, plays a pivotal role in phosphorylating a diverse array of substrates with acidic residues located C-terminal to the phosphorylated serine or threonine. This versatile protein regulator is involved in regulating critical cellular processes, including cell cycle progression, apoptosis, and transcription, as well as influencing viral infection. Acting as a central regulatory node, CSNK2A2 integrates and coordinates various signals, orchestrating an appropriate cellular response. During mitosis, it functions within the p53/TP53-dependent spindle assembly checkpoint, preserving cyclin-B-CDK1 activity and inducing G2 arrest in response to spindle damage. Furthermore, CSNK2A2 is essential for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 after UV irradiation, and it exerts a negative regulatory effect on apoptosis. Notably, CSNK2A2 displays a broad impact on cellular signaling, phosphorylating caspases, apoptotic regulator NOL3, RNA polymerases, and numerous transcription factors. Its influence extends to molecular chaperones, such as Hsp90 and its co-chaperones, highlighting its essential role in chaperone function. Additionally, CSNK2A2 regulates Wnt signaling, acts as an ectokinase for extracellular proteins, and exerts its influence during viral infection by phosphorylating proteins involved in the life cycles of various viruses, underscoring its multifaceted and crucial role in cellular homeostasis.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P19784 (M1-R350)

Gene ID
Molecular Construction
N-term
His-GST
CSNK2A2 (M1-R350)
Accession # P19784
C-term
Protein Length

Full Length

Synonyms
Casein kinase II subunit alpha'; CK II alpha'; CSNK2A2; CK2A2
AA Sequence

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Predicted Molecular Mass
69 kDa
Molecular Weight

Approximately 60 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CK2 alpha/CSNK2A2 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P76297
Quantity:
MCE Japan Authorized Agent: